PRAK Antibody

Images

 
Western Blot: PRAK Antibody [H00008550-D01P] - Analysis of MAPKAPK5 expression in transfected 293T cell line by MAPKAPK5 polyclonal antibody.Lane 1: MAPKAPK5 transfected lysate(54.00 KDa).Lane 2: Non-transfected lysate.
Western Blot: PRAK Antibody [H00008550-D01P] - analysis of MAPKAPK5 expression in transfected 293T cell line by MAPKAPK5 MaxPab rabbit polyclonal antibody. Lane 1: MAPKAPK5 transfected lysate (54.00 KDa). Lane 2: ...read more
Proximity Ligation Assay: PRAK Antibody [H00008550-D01P] - Analysis of protein-protein interactions between MAPKAPK5 and EIF4EBP1. HeLa cells were stained with anti-MAPKAPK5 rabbit purified polyclonal 1:1200 and ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, PLA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRAK Antibody Summary

Immunogen
MAPKAPK5 (NP_003659.2, 1 a.a. - 471 a.a.) full-length human protein. MSEESDMDKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKARNEVRLHMMCATHPNIVQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHFTEKQASQVTKQIALALRHCHLLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKIDQGDLMTPQFTPYYVAPQVLEAQRRHQKEKSGIIPTSPTPYTYNKSCDLWSLGVIIYVMLCGYPPFYSKHHSRTIPKDMRRKIMTGSFEFPEEEWSQISEMAKDVVRKLLKVKPEERLTIEGVLDHPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLKPLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ
Specificity
MAPKAPK5 - mitogen-activated protein kinase-activated protein kinase 5,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAPKAPK5
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PRAK Antibody

  • EC 2.7.11
  • MAP kinase-activated protein kinase 5
  • MAPK-activated protein kinase 5
  • MAPKAP kinase 5
  • MAPKAPK-5
  • mitogen-activated protein kinase-activated protein kinase 5
  • p38-regulated/activated protein kinase
  • PRAKEC 2.7.11.1

Background

The protein encoded by this gene is a member of the serine/threonine kinase family. In response to cellular stress and proinflammatory cytokines, this kinase is activated through its phosphorylation by MAP kinases including MAPK1/ERK, MAPK14/p38-alpha, and MAPK11/p38-beta. In vitro, this kinase phosphorylates heat shock protein HSP27 at its physiologically relevant sites. Two alternately spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3196
Species: Hu
Applications: WB, IHC
NBP2-45743
Species: Hu
Applications: WB, IHC, IF
H00009261-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, PLA
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-42802
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF2848
Species: Hu, Mu
Applications: WB, ICC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003738-M01
Species: Hu
Applications: WB, ELISA
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
H00008550-D01P
Species: Hu
Applications: WB, PLA

Publications for PRAK Antibody (H00008550-D01P) (0)

There are no publications for PRAK Antibody (H00008550-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRAK Antibody (H00008550-D01P) (0)

There are no reviews for PRAK Antibody (H00008550-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRAK Antibody (H00008550-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRAK Products

Bioinformatics Tool for PRAK Antibody (H00008550-D01P)

Discover related pathways, diseases and genes to PRAK Antibody (H00008550-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRAK Antibody (H00008550-D01P)

Discover more about diseases related to PRAK Antibody (H00008550-D01P).
 

Pathways for PRAK Antibody (H00008550-D01P)

View related products by pathway.

PTMs for PRAK Antibody (H00008550-D01P)

Learn more about PTMs related to PRAK Antibody (H00008550-D01P).
 

Research Areas for PRAK Antibody (H00008550-D01P)

Find related products by research area.

Blogs on PRAK

There are no specific blogs for PRAK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRAK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPKAPK5
Entrez
Uniprot