![Western Blot: PPT2 Antibody [NBP2-86755] - Host: Rabbit. Target Name: PPT2. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize2/PPT2-Antibody-Western-Blot-NBP2-86755-img0001.jpg "Western Blot: PPT2 Antibody [NBP2-86755] - Host: Rabbit. Target Name: PPT2. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human PPT2. Peptide sequence: DLYLNASSFLALINGERDHPNATVWRKNFLRVGHLVLIGGPDDGVITPWQ The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PPT2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot: STK19 Antibody [NBP1-84308] - Analysis in control (vector only transfected HEK293T lysate) and STK19 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/images2/STK19-Antibody-Western-Blot-NBP1-84308-img0004.jpg)
![Immunohistochemistry-Paraffin: STK19 Antibody [NBP1-84308] - Staining of human pancreas shows no nuclear positivity in exocrine glandular cells.](http://images.novusbio.com/images2/STK19-Antibody-Immunohistochemistry-Paraffin-NBP1-84308-img0005.jpg)
![Immunohistochemistry-Paraffin: STK19 Antibody [NBP1-84308] - Staining of human stomach shows no nuclear positivity in glandular cells.](http://images.novusbio.com/images2/STK19-Antibody-Immunohistochemistry-Paraffin-NBP1-84308-img0006.jpg)
![Western Blot: AGPAT1 Antibody [NBP2-57898] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.](http://images.novusbio.com/images2/AGPAT1-Antibody-Western-Blot-NBP2-57898-img0002.jpg)
![Immunohistochemistry-Paraffin: AGPAT1 Antibody [NBP2-57898] - Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells and glial cells.](http://images.novusbio.com/images2/AGPAT1-Antibody-Immunohistochemistry-Paraffin-NBP2-57898-img0001.jpg)
![Immunohistochemistry-Paraffin: RNF5 Antibody [NBP2-94913] - Human liver cancer using RNF5 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/images2/RNF5-Antibody-Immunohistochemistry-Paraffin-NBP2-94913-img0001.jpg)
![Immunohistochemistry-Paraffin: RNF5 Antibody [NBP2-94913] - Mouse heart using RNF5 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/images2/RNF5-Antibody-Immunohistochemistry-Paraffin-NBP2-94913-img0002.jpg)
![Western Blot: RNF5 Antibody [NBP2-94913] - Analysis of extracts of various cell lines, using RNF5 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 30s.](http://images.novusbio.com/images2/RNF5-Antibody-Western-Blot-NBP2-94913-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: G protein alpha-13 Antibody [NBP3-03844] - Analysis of C6 cells using G protein alpha-13 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/images2/G-protein-alpha-13-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03844-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: G protein alpha-13 Antibody [NBP3-03844] - Analysis of NIH-3T3 cells using G protein alpha-13 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/images2/G-protein-alpha-13-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03844-img0002.jpg)
![Immunohistochemistry-Paraffin: G protein alpha-13 Antibody [NBP3-03844] - Paraffin-embedded mouse kidney using G protein alpha-13 antibody (40x lens).](http://images.novusbio.com/images2/G-protein-alpha-13-Antibody-Immunohistochemistry-Paraffin-NBP3-03844-img0003.jpg)
![Western Blot: RBM6 Antibody [NBP1-89376] - Analysis in human cell line Daudi.](http://images.novusbio.com/images2/RBM6-Antibody-Western-Blot-NBP1-89376-img0011.jpg)
![Immunohistochemistry-Paraffin: RBM6 Antibody [NBP1-89376] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.](http://images.novusbio.com/images2/RBM6-Antibody-Immunohistochemistry-Paraffin-NBP1-89376-img0012.jpg)
![Immunohistochemistry-Paraffin: RBM6 Antibody [NBP1-89376] - Staining of human colon shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/images2/RBM6-Antibody-Immunohistochemistry-Paraffin-NBP1-89376-img0013.jpg)
![Western Blot: ACOT8 Antibody [NBP1-32452] - Sample(30 ug whole cell lysate)A:MOLT4 B:Raji 10% SDS PAGE, antibody diluted at 1:1000.](http://images.novusbio.com/images2/ACOT8-Antibody-Western-Blot-NBP1-32452-img0002.jpg)
![Western Blot: ACOT8 Antibody [NBP1-32452] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with ACOT8 antibody diluted by 1:1000.](http://images.novusbio.com/images2/ACOT8-Antibody-Western-Blot-NBP1-32452-img0003.jpg)
![Western Blot: ACOT8 Antibody [NBP1-32452] - Mouse tissue extracts (50 ug) was separated by 10 % SDS-PAGE, and the membrane was blotted with ACOT8 antibody diluted by 1:1000.](http://images.novusbio.com/images2/ACOT8-Antibody-Western-Blot-NBP1-32452-img0004.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for PPT2 Antibody (NBP2-86755)Discover more about diseases related to PPT2 Antibody (NBP2-86755).
| Pathways for PPT2 Antibody (NBP2-86755)View related products by pathway.
|
PTMs for PPT2 Antibody (NBP2-86755)Learn more about PTMs related to PPT2 Antibody (NBP2-86755).
| Research Areas for PPT2 Antibody (NBP2-86755)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PPT2 |
![Western Blot: PPT1 Antibody [NBP1-85563] - Analysis in human cell line THP-1.](http://images.novusbio.com/images2/PPT1-Antibody-Western-Blot-NBP1-85563-img0006.jpg)
![Immunohistochemistry-Paraffin: PPT1 Antibody [NBP1-85563] - Staining of human cerebral cortex shows very strong granular positivity in cytoplasm in neurons.](http://images.novusbio.com/images2/PPT1-Antibody-Immunohistochemistry-Paraffin-NBP1-85563-img0007.jpg)
![Immunohistochemistry-Paraffin: PPT1 Antibody [NBP1-85563] - Staining of human lung shows very strong granular positivity in cytoplasm in macrophages.](http://images.novusbio.com/images2/PPT1-Antibody-Immunohistochemistry-Paraffin-NBP1-85563-img0008.jpg)
![Immunohistochemistry-Paraffin: ATF6 beta Antibody [NBP1-91687] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/images2/ATF6-beta-Antibody-Immunohistochemistry-Paraffin-NBP1-91687-img0008.jpg)
![Immunohistochemistry-Paraffin: ATF6 beta Antibody [NBP1-91687] - Staining of human testis shows strong nuclear and cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/images2/ATF6-beta-Antibody-Immunohistochemistry-Paraffin-NBP1-91687-img0009.jpg)
![Immunohistochemistry-Paraffin: ATF6 beta Antibody [NBP1-91687] - Staining of human lymph node shows moderate nuclear positivity in non-germinal center cells.](http://images.novusbio.com/images2/ATF6-beta-Antibody-Immunohistochemistry-Paraffin-NBP1-91687-img0010.jpg)
![Immunocytochemistry/Immunofluorescence: RBM5 Antibody (2B6) [H00010181-M01] - Analysis of monoclonal antibody to RBM5 on HeLa cell . Antibody concentration 10 ug/ml.](http://images.novusbio.com/images2/RBM5-Antibody-(2B6)-Immunocytochemistry-Immunofluorescence-H00010181-M01-img0005.jpg)
![Immunohistochemistry-Paraffin: RBM5 Antibody (2B6) [H00010181-M01] - Analysis of monoclonal antibody to RBM5 on formalin-fixed paraffin-embedded human lung. Antibody concentration 3 ug/ml.](http://images.novusbio.com/images2/RBM5-Antibody-(2B6)-Immunohistochemistry-Paraffin-H00010181-M01-img0007.jpg)
![Western Blot: RBM5 Antibody (2B6) [H00010181-M01] - Analysis of RBM5 expression in transfected 293T cell line by RBM5 monoclonal antibody (M01), clone 2B6.Lane 1: RBM5 transfected lysate(61.5 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/images2/RBM5-Antibody-(2B6)-Western-Blot-H00010181-M01-img0009.jpg)
![Immunohistochemistry-Paraffin: MSH5 Antibody [NBP1-20946] - Staining of Human Thymus. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.](http://images.novusbio.com/images2/MSH5-Antibody-Immunohistochemistry-Paraffin-NBP1-20946-img0002.jpg)
![Immunohistochemistry-Paraffin: MSH5 Antibody [NBP1-20946] - Staining of paraffin embedded Human Testis. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.](http://images.novusbio.com/images2/MSH5-Antibody-Immunohistochemistry-Paraffin-NBP1-20946-img0001.jpg)
![Western Blot: CLIC1 Antibody (2D4) [H00001192-M01] - CLIC1 monoclonal antibody (M01), clone 2D4 Analysis of CLIC1 expression in HL-60.](http://images.novusbio.com/images2/CLIC1-Antibody-(2D4)-Western-Blot-H00001192-M01-img0009.jpg)
![Immunocytochemistry/Immunofluorescence: CLIC1 Antibody (2D4) [H00001192-M01] - Analysis of monoclonal antibody to CLIC1 on HeLa cell . Antibody concentration 10 ug/ml.](http://images.novusbio.com/images2/CLIC1-Antibody-(2D4)-Immunocytochemistry-Immunofluorescence-H00001192-M01-img0005.jpg)
![Immunohistochemistry-Paraffin: CLIC1 Antibody (2D4) [H00001192-M01] - Analysis of monoclonal antibody to CLIC1 on formalin-fixed paraffin-embedded human colon tissue. Antibody concentration 3 ug/ml.](http://images.novusbio.com/images2/CLIC1-Antibody-(2D4)-Immunohistochemistry-Paraffin-H00001192-M01-img0007.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](http://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
