PPT2 Antibody

Images

 
Western Blot: PPT2 Antibody [NBP2-86755] - Host: Rabbit. Target Name: PPT2. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPT2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PPT2. Peptide sequence: DLYLNASSFLALINGERDHPNATVWRKNFLRVGHLVLIGGPDDGVITPWQ The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
PPT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPT2 Antibody

  • C6orf8
  • DKFZp564P1516
  • EC 3.1.2
  • EC 3.1.2.-
  • G14
  • lysosomal thioesterase PPT2
  • palmitoyl-protein hydrolase 2
  • palmitoyl-protein thioesterase 2
  • PPT-2
  • S-thioesterase G14
  • VE-statin2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85563
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-84308
Species: Hu
Applications: IHC, IHC-P, WB
DY417
Species: Mu
Applications: ELISA
NBP1-91687
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00010181-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP2-57898
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-20946
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-94913
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-03844
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89376
Species: Hu
Applications: IHC, IHC-P, WB
AF3194
Species: Hu
Applications: ICC, Simple Western, WB
H00001192-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-32452
Species: Hu, Mu, Rt
Applications: WB
AF6438
Species: Hu, Mu, Rt
Applications: ICC, WB
H00063940-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-86755
Species: Hu
Applications: WB

Publications for PPT2 Antibody (NBP2-86755) (0)

There are no publications for PPT2 Antibody (NBP2-86755).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPT2 Antibody (NBP2-86755) (0)

There are no reviews for PPT2 Antibody (NBP2-86755). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPT2 Antibody (NBP2-86755) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPT2 Products

Bioinformatics Tool for PPT2 Antibody (NBP2-86755)

Discover related pathways, diseases and genes to PPT2 Antibody (NBP2-86755). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPT2 Antibody (NBP2-86755)

Discover more about diseases related to PPT2 Antibody (NBP2-86755).
 

Pathways for PPT2 Antibody (NBP2-86755)

View related products by pathway.

PTMs for PPT2 Antibody (NBP2-86755)

Learn more about PTMs related to PPT2 Antibody (NBP2-86755).
 

Research Areas for PPT2 Antibody (NBP2-86755)

Find related products by research area.

Blogs on PPT2

There are no specific blogs for PPT2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPT2