Recombinant Human PPP2R4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PPP2R4 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 21 - 120 of Human PPP2R4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLV

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PPP2R4
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PPP2R4 Protein

  • EC 5.2.1.8
  • MGC2184
  • Phosphotyrosyl phosphatase activator
  • PP2A phosphatase activator
  • PP2A subunit B' isoform PR53
  • PP2A
  • PP2A, subunit B', PR53 isoform
  • PPP2R4
  • protein phosphatase 2A activator, regulatory subunit 4
  • PTPA
  • regulatory subunit B' (PR 53)
  • serine/threonine-protein phosphatase 2A activator
  • Serine/threonine-protein phosphatase 2A regulatory subunit 4
  • Serine/threonine-protein phosphatase 2A regulatory subunit B'

Background

PPP2R4 - protein phosphatase 2A, regulatory subunit B' (PR 53)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-31266
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PPP2R4 Partial Recombinant Protein (H00005524-Q01) (0)

There are no publications for PPP2R4 Partial Recombinant Protein (H00005524-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP2R4 Partial Recombinant Protein (H00005524-Q01) (0)

There are no reviews for PPP2R4 Partial Recombinant Protein (H00005524-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPP2R4 Partial Recombinant Protein (H00005524-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPP2R4 Products

Bioinformatics Tool for PPP2R4 Partial Recombinant Protein (H00005524-Q01)

Discover related pathways, diseases and genes to PPP2R4 Partial Recombinant Protein (H00005524-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP2R4 Partial Recombinant Protein (H00005524-Q01)

Discover more about diseases related to PPP2R4 Partial Recombinant Protein (H00005524-Q01).
 

Pathways for PPP2R4 Partial Recombinant Protein (H00005524-Q01)

View related products by pathway.

PTMs for PPP2R4 Partial Recombinant Protein (H00005524-Q01)

Learn more about PTMs related to PPP2R4 Partial Recombinant Protein (H00005524-Q01).
 

Research Areas for PPP2R4 Partial Recombinant Protein (H00005524-Q01)

Find related products by research area.

Blogs on PPP2R4

There are no specific blogs for PPP2R4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PPP2R4 Antibody
NBP1-87232

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PPP2R4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP2R4
Entrez