PPP2R4 Antibody

Western Blot: PPP2R4 Antibody [H00005524-B01P] - Analysis of PPP2R4 expression in transfected 293T cell line by PPP2R4 polyclonal antibody. Lane 1: PPP2R4 transfected lysate(35.53 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: PPP2R4 Antibody [H00005524-B01P] - Analysis of purified antibody to PPP2R4 on HeLa cell. (antibody concentration 10 ug/ml)

Product Discontinued

PPP2R4 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: PPP2R4 (NP_066954.2, 1 a.a. - 323 a.a.) full-length human protein. MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG
• Specificity: PPP2R4 - protein phosphatase 2A, regulatory subunit B' (PR 53),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: PPP2R4
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PPP2R4 Antibody

• EC 5.2.1.8
• MGC2184
• Phosphotyrosyl phosphatase activator
• PP2A phosphatase activator
• PP2A subunit B' isoform PR53
• PP2A
• PP2A, subunit B', PR53 isoform
• PPP2R4
• protein phosphatase 2A activator, regulatory subunit 4
• PTPA
• regulatory subunit B' (PR 53)
• serine/threonine-protein phosphatase 2A activator
• Serine/threonine-protein phosphatase 2A regulatory subunit 4
• Serine/threonine-protein phosphatase 2A regulatory subunit B'

Background

Protein phosphatase 2A is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2A holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B' family. This gene encodes a specific phosphotyrosyl phosphatase activator of the dimeric form of protein phosphatase 2A. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP2R4
• Entrez:
  • 5524 (Human)
• Uniprot:
  • NP_066954.2(Human)