Recombinant Human PPP1R14B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PPP1R14B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 64-139 of Human PPP1R14B partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ELRKRLNLEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PPP1R14B
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PPP1R14B Protein

  • PHI-1
  • PLCB3Nphospholipase C beta-3 neighboring gene protein
  • PNGPhospholipase C-beta-3 neighbouring gene protein
  • protein phosphatase 1 regulatory subunit 14B
  • protein phosphatase 1, regulatory (inhibitor) subunit 14B
  • SOM172

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37897
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50509
Species: Hu
Applications: IHC, IP
NBP2-00814
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-87294
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
232-FA/CF
Species: Hu
NBP1-82268
Species: Hu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-89772
Species: Hu
Applications: IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NB100-215
Species: Hu, Mu
Applications: WB, IHC-P, IP
AF4716
Species: Hu
Applications: WB
NBP1-81610
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PPP1R14B Partial Recombinant Protein (H00026472-Q01) (0)

There are no publications for PPP1R14B Partial Recombinant Protein (H00026472-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP1R14B Partial Recombinant Protein (H00026472-Q01) (0)

There are no reviews for PPP1R14B Partial Recombinant Protein (H00026472-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPP1R14B Partial Recombinant Protein (H00026472-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPP1R14B Products

Bioinformatics Tool for PPP1R14B Partial Recombinant Protein (H00026472-Q01)

Discover related pathways, diseases and genes to PPP1R14B Partial Recombinant Protein (H00026472-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP1R14B Partial Recombinant Protein (H00026472-Q01)

Discover more about diseases related to PPP1R14B Partial Recombinant Protein (H00026472-Q01).
 

Pathways for PPP1R14B Partial Recombinant Protein (H00026472-Q01)

View related products by pathway.

PTMs for PPP1R14B Partial Recombinant Protein (H00026472-Q01)

Learn more about PTMs related to PPP1R14B Partial Recombinant Protein (H00026472-Q01).

Blogs on PPP1R14B

There are no specific blogs for PPP1R14B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PPP1R14B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R14B