PPFIA4 Recombinant Protein Antigen

Images

 
There are currently no images for PPFIA4 Recombinant Protein Antigen (NBP2-31560PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PPFIA4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPFIA4.

Source: E. coli

Amino Acid Sequence: ERVTTLEEQLAGAHQQVSALQQGAGVRDGAAEEEGTVELGPKRLWKEDTGRVEELQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPFIA4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-31560.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PPFIA4 Recombinant Protein Antigen

  • KIAA0897
  • liprin alpha4
  • Liprin-alpha4
  • liprin-alpha-4
  • Protein tyrosine phosphatase receptor type f polypeptide-interacting proteinalpha-4
  • protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interactingprotein (liprin), alpha 4
  • PTPRF-interacting protein alpha-4

Background

PPFIA4, also referred to as Liprin-alpha-4, has a 701 amino acid long isoform that is approximately 78kDa and a slightly shorter 692 amino acid long isoform that is approximately 77kDa. PPFIA4 is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family, and is expressed in the skeletal muscle, heart, and brain. Liprin family members, such as PPFIA4, interact with the LAR family of transmembrane PTPs, which are essential players in mammary gland development and axon guidance. Research has shown that PPFIA4 could play a role in the disassembly of focal adhesions. Current research on PPFIA4 is being performed in relation to several diseases and disorders including hypoxia, hypertension, ataxia, and neuronitis. PPFIA4 has also been shown to interact with GIT1, NCOA2, ERC2, PLCG1, and AGTPBP1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41211
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-46018
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
NBP3-30337
Species: Hu, Mu
Applications: WB
NBP2-30453
Species: Hu
Applications: IHC,  IHC-P
AF3004
Species: Hu, Mu, Rt
Applications: WB
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-76718
Species: Hu
Applications: ELISA
NBP2-22423
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, KO, WB
NBP1-80033
Species: Hu
Applications: WB
NB100-79810
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP1-33037
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-01819
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
NBP2-19676
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00005662-B01P
Species: Hu, Rt
Applications: ICC/IF, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
DSHBG0B
Species: Hu
Applications: ELISA

Publications for PPFIA4 Recombinant Protein Antigen (NBP2-31560PEP) (0)

There are no publications for PPFIA4 Recombinant Protein Antigen (NBP2-31560PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPFIA4 Recombinant Protein Antigen (NBP2-31560PEP) (0)

There are no reviews for PPFIA4 Recombinant Protein Antigen (NBP2-31560PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PPFIA4 Recombinant Protein Antigen (NBP2-31560PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPFIA4 Products

Array NBP2-31560PEP

Research Areas for PPFIA4 Recombinant Protein Antigen (NBP2-31560PEP)

Find related products by research area.

Blogs on PPFIA4

There are no specific blogs for PPFIA4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PPFIA4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPFIA4