PPFIA4 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPFIA4. Source: E. coli
Amino Acid Sequence: ERVTTLEEQLAGAHQQVSALQQGAGVRDGAAEEEGTVELGPKRLWKEDTGRVEELQ Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
PPFIA4 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-31560.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for PPFIA4 Recombinant Protein Antigen
Background
PPFIA4, also referred to as Liprin-alpha-4, has a 701 amino acid long isoform that is approximately 78kDa and a slightly shorter 692 amino acid long isoform that is approximately 77kDa. PPFIA4 is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family, and is expressed in the skeletal muscle, heart, and brain. Liprin family members, such as PPFIA4, interact with the LAR family of transmembrane PTPs, which are essential players in mammary gland development and axon guidance. Research has shown that PPFIA4 could play a role in the disassembly of focal adhesions. Current research on PPFIA4 is being performed in relation to several diseases and disorders including hypoxia, hypertension, ataxia, and neuronitis. PPFIA4 has also been shown to interact with GIT1, NCOA2, ERC2, PLCG1, and AGTPBP1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, KO, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA
Publications for PPFIA4 Recombinant Protein Antigen (NBP2-31560PEP) (0)
There are no publications for PPFIA4 Recombinant Protein Antigen (NBP2-31560PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PPFIA4 Recombinant Protein Antigen (NBP2-31560PEP) (0)
There are no reviews for PPFIA4 Recombinant Protein Antigen (NBP2-31560PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for PPFIA4 Recombinant Protein Antigen (NBP2-31560PEP) (0)
Additional PPFIA4 Products
Research Areas for PPFIA4 Recombinant Protein Antigen (NBP2-31560PEP)
Find related products by research area.
|
Blogs on PPFIA4