Recombinant Human PPFIA4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PPFIA4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 604-699 of Human PPFIA4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RQVMEREFNNLLALGTDRKLDDGDDKVFRRAPSWRKRFRPREHHGRGGMLSASAETLPAGFRVSTLGTLQPPPAPPKKIMPEAHSHYLYGHMLSAF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PPFIA4
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PPFIA4 Protein

  • KIAA0897
  • liprin alpha4
  • Liprin-alpha4
  • liprin-alpha-4
  • Protein tyrosine phosphatase receptor type f polypeptide-interacting proteinalpha-4
  • protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interactingprotein (liprin), alpha 4
  • PTPRF-interacting protein alpha-4

Background

PPFIA4 - protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
21720002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-92335
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-30453
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-42172
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, ICC
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00085329-T01
Species: Hu
MAB8508
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-88911
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
MAB6188
Species: Hu
Applications: IHC
NB120-3515
Species: Hu, Rt, Po, Bv, Ca, Fi, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, ICC
H00010849-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-15083
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-58006
Species: Hu
Applications: WB, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-45825
Species: Hu
Applications: WB, IHC
H00008497-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PPFIA4 Partial Recombinant Protein (H00008497-Q01) (0)

There are no publications for PPFIA4 Partial Recombinant Protein (H00008497-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPFIA4 Partial Recombinant Protein (H00008497-Q01) (0)

There are no reviews for PPFIA4 Partial Recombinant Protein (H00008497-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPFIA4 Partial Recombinant Protein (H00008497-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPFIA4 Products

Bioinformatics Tool for PPFIA4 Partial Recombinant Protein (H00008497-Q01)

Discover related pathways, diseases and genes to PPFIA4 Partial Recombinant Protein (H00008497-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for PPFIA4 Partial Recombinant Protein (H00008497-Q01)

View related products by pathway.

PTMs for PPFIA4 Partial Recombinant Protein (H00008497-Q01)

Learn more about PTMs related to PPFIA4 Partial Recombinant Protein (H00008497-Q01).
 

Research Areas for PPFIA4 Partial Recombinant Protein (H00008497-Q01)

Find related products by research area.

Blogs on PPFIA4

There are no specific blogs for PPFIA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PPFIA4 Antibody
NBP2-31560

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PPFIA4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PPFIA4