POMT2 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: GDGFFSSAFQARLSGNNLHNASIPEHLAYGSVITVKNLRMAIGYLHSHRHLYPEGIGARQQQVTTYLHKDYNNLWIIKKHNTNSDPLDPSFPVEFVRHGDIIRLEHKETSRNLHSHYHEAPMTRKHYQVTGYGINGT |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
POMT2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for POMT2 Antibody - BSA Free
Background
POMT2, also known as Protein-O-Mannosyltransferase 2, is an O-mannosyltransferase that must interact with POMT1 for proper enzymatic function. POMT2 is localized to the Endoplasmic Reticulum membrane, and is ubiquitously expressed at low levels, however highly expressed in the testes. Current research surrounding POMT2 has shown a connection with autosomal recessive muscular dystrophy, as well as possible interactions with Walker-Warburg syndrome, cleft palate, and malaria. POMT2 interacts with POMT1, ALG3, ALG6, ARPC3, and ATP13A1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: IHC, KO, WB
Species: Rt
Applications: BA, BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Publications for POMT2 Antibody (NBP1-86152) (0)
There are no publications for POMT2 Antibody (NBP1-86152).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for POMT2 Antibody (NBP1-86152) (0)
There are no reviews for POMT2 Antibody (NBP1-86152).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for POMT2 Antibody (NBP1-86152) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional POMT2 Products
Blogs on POMT2