POMT2 Antibody

Images

 
Western Blot: POMT2 Antibody [NBP1-86152] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: POMT2 Antibody [NBP1-86152] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.
Western Blot: POMT2 Antibody [NBP1-86152] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, Rt, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

POMT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GDGFFSSAFQARLSGNNLHNASIPEHLAYGSVITVKNLRMAIGYLHSHRHLYPEGIGARQQQVTTYLHKDYNNLWIIKKHNTNSDPLDPSFPVEFVRHGDIIRLEHKETSRNLHSHYHEAPMTRKHYQVTGYGINGT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POMT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
POMT2 Protein (NBP1-86152PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for POMT2 Antibody

  • DKFZp686G10254
  • Dolichyl-phosphate-mannose--protein mannosyltransferase 2
  • EC 2.4.1.109
  • FLJ22309
  • MDDGA2
  • MDDGB2
  • MDDGC2
  • protein O-mannosyl-transferase 2
  • protein-O-mannosyltransferase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57200
Species: Hu
Applications: ICC/IF
NBP1-33383
Species: Hu
Applications: WB, ICC/IF
NBP2-55584
Species: Hu
Applications: ICC/IF
NBP1-33084
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49865
Species: Hu
Applications: WB, PEP-ELISA
AF550
Species: Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
MAB3518
Species: Mu
Applications: Flow, CyTOF-ready
NBP1-81216
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP2-48769
Species: Hu
Applications: IHC
NBP1-86152
Species: Hu, Mu, Rt, Mu
Applications: WB, IHC, IHC-P

Publications for POMT2 Antibody (NBP1-86152) (0)

There are no publications for POMT2 Antibody (NBP1-86152).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POMT2 Antibody (NBP1-86152) (0)

There are no reviews for POMT2 Antibody (NBP1-86152). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POMT2 Antibody (NBP1-86152) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional POMT2 Products

Bioinformatics Tool for POMT2 Antibody (NBP1-86152)

Discover related pathways, diseases and genes to POMT2 Antibody (NBP1-86152). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POMT2 Antibody (NBP1-86152)

Discover more about diseases related to POMT2 Antibody (NBP1-86152).
 

Pathways for POMT2 Antibody (NBP1-86152)

View related products by pathway.

PTMs for POMT2 Antibody (NBP1-86152)

Learn more about PTMs related to POMT2 Antibody (NBP1-86152).

Blogs on POMT2

There are no specific blogs for POMT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POMT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POMT2