PLGLB2 Antibody (3E6)

Images

 
Western Blot: PLGLB2 Antibody (3E6) [H00005342-M04] - Western Blot analysis of PLGLB2 expression in PC-12 ( Cat # L012V1 ).
Immunocytochemistry/ Immunofluorescence: PLGLB2 Antibody (3E6) [H00005342-M04] - Analysis of monoclonal antibody to PLGLB2 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: PLGLB2 Antibody (3E6) [H00005342-M04] - Analysis of monoclonal antibody to PLGLB2 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml
ELISA: PLGLB2 Antibody (3E6) [H00005342-M04] - Detection limit for recombinant GST tagged PLGLB2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P
Clone
3E6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PLGLB2 Antibody (3E6) Summary

Immunogen
PLGLB2 (NP_002656, 21 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PLDDYVNTQGPSLFSVTKKQLGAGSREECAAKCEEDKEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDAVLFEK
Specificity
PLGLB2 - plasminogen-like B2 (3E6)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PLGLB2
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Ascites

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PLGLB2 Antibody (3E6)

  • EC 3.4.21.7
  • plasminogen pseudogene 1
  • plasminogen-like B2
  • plasminogen-related protein B
  • PLGL
  • PLGLB1
  • PLGP1
  • PRGB
  • type B plasminogen related

Background

Plasminogen related protein B is encoded by the PLGLB1 and PLGLB2 genes. It may bind to lysine binding sites present in the kringle structures of plasminogen interfering with the binding of fibrin or alpha-2-antiplasmin to plasminogen.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-930
Species: Hu, Rt
Applications: ELISA, WB
NBP2-56751
Species: Hu
Applications: ICC/IF
233-FB/CF
Species: Hu
Applications: BA
AF226
Species: Hu
Applications: WB
DVE00
Species: Hu
Applications: ELISA
DNST0
Species: Hu
Applications: ELISA
NB110-41083
Species: Hu
Applications: ChIP, ELISA, ICC/IF, WB
NB100-2452
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
AF3628
Species: Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, WB
H00005342-M04
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for PLGLB2 Antibody (H00005342-M04) (0)

There are no publications for PLGLB2 Antibody (H00005342-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLGLB2 Antibody (H00005342-M04) (0)

There are no reviews for PLGLB2 Antibody (H00005342-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PLGLB2 Antibody (H00005342-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLGLB2 Products

Array H00005342-M04

Bioinformatics Tool for PLGLB2 Antibody (H00005342-M04)

Discover related pathways, diseases and genes to PLGLB2 Antibody (H00005342-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PLGLB2

There are no specific blogs for PLGLB2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLGLB2 Antibody (3E6) and receive a gift card or discount.

Bioinformatics

Gene Symbol PLGLB2