PLGLB2 Antibody (3E6) Summary
Immunogen |
PLGLB2 (NP_002656, 21 a.a. ~ 96 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PLDDYVNTQGPSLFSVTKKQLGAGSREECAAKCEEDKEFTCRAFQYHSKEQQCVIMAENRKSSIIIRMRDAVLFEK |
Specificity |
PLGLB2 - plasminogen-like B2 (3E6) |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
PLGLB2 |
Purity |
Ascites |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1:500
|
Application Notes |
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
Ascites |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for PLGLB2 Antibody (3E6)
Background
Plasminogen related protein B is encoded by the PLGLB1 and PLGLB2 genes. It may bind to lysine binding sites present in the kringle structures of plasminogen interfering with the binding of fibrin or alpha-2-antiplasmin to plasminogen.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ChIP, ELISA, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Publications for PLGLB2 Antibody (H00005342-M04) (0)
There are no publications for PLGLB2 Antibody (H00005342-M04).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PLGLB2 Antibody (H00005342-M04) (0)
There are no reviews for PLGLB2 Antibody (H00005342-M04).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PLGLB2 Antibody (H00005342-M04) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PLGLB2 Products
Bioinformatics Tool for PLGLB2 Antibody (H00005342-M04)
Discover related pathways, diseases and genes to PLGLB2 Antibody (H00005342-M04). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Blogs on PLGLB2