![Immunohistochemistry-Paraffin: PLEKHG3 Antibody [NBP2-68986] - Staining of human liver.](http://images.novusbio.com/fullsize2/PLEKHG3-Antibody-Immunohistochemistry-Paraffin-NBP2-68986-img0005.jpg "Immunohistochemistry-Paraffin: PLEKHG3 Antibody [NBP2-68986] - Staining of human liver.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SFESISSLPEVEPDPEAGSEQEVFSAVEGPSAEETPSDTESPEVLETQLDAHQGLLGMDPPGDMVDFVAA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PLEKHG3 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Recommended conditions for IHC,Retrieval method: HIER pH6 |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
-Immunohistochemistry-NB300-574-img0010.jpg)
-Flow-Cytometry-NB300-574-img0001.jpg)
-Flow-Cytometry-NB300-574-img0002.jpg)
-Immunohistochemistry-Frozen-NBP2-59690-img0002.jpg)
-Western-Blot-NBP2-59690-img0004.jpg)
-Immunohistochemistry-NBP2-59690-img0006.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for PLEKHG3 Antibody (NBP2-68986)Discover more about diseases related to PLEKHG3 Antibody (NBP2-68986).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PLEKHG3 |
![Immunohistochemistry: PLEKHG3 Antibody [NBP2-68986] - Immunohistochemical staining of human endometrium shows moderate membranous positivity in glandular cells.](http://images.novusbio.com/fullsize2/PLEKHG3-Antibody-Immunohistochemistry-NBP2-68986-img0001.jpg "Immunohistochemistry: PLEKHG3 Antibody [NBP2-68986] - Immunohistochemical staining of human endometrium shows moderate membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PLEKHG3 Antibody [NBP2-68986] - Staining of human cerebral cortex, colon, kidney and liver using Anti-PLEKHG3 antibody NBP2-68986 (A) shows similar protein distribution across tissues to independent antibody NBP2-68967 (B).](http://images.novusbio.com/fullsize2/PLEKHG3-Antibody-Immunohistochemistry-Paraffin-NBP2-68986-img0002.jpg "Immunohistochemistry-Paraffin: PLEKHG3 Antibody [NBP2-68986] - Staining of human cerebral cortex, colon, kidney and liver using Anti-PLEKHG3 antibody NBP2-68986 (A) shows similar protein distribution across tissues to independent antibody NBP2-68967 (B).")
![Immunohistochemistry-Paraffin: PLEKHG3 Antibody [NBP2-68986] - Staining of human kidney.](http://images.novusbio.com/fullsize2/PLEKHG3-Antibody-Immunohistochemistry-Paraffin-NBP2-68986-img0003.jpg "Immunohistochemistry-Paraffin: PLEKHG3 Antibody [NBP2-68986] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: PLEKHG3 Antibody [NBP2-68986] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize2/PLEKHG3-Antibody-Immunohistochemistry-Paraffin-NBP2-68986-img0004.jpg "Immunohistochemistry-Paraffin: PLEKHG3 Antibody [NBP2-68986] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: PLEKHG3 Antibody [NBP2-68986] - Staining of human colon.](http://images.novusbio.com/fullsize2/PLEKHG3-Antibody-Immunohistochemistry-Paraffin-NBP2-68986-img0006.jpg "Immunohistochemistry-Paraffin: PLEKHG3 Antibody [NBP2-68986] - Staining of human colon.")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")