PLEKHA3 Antibody

Images

 
Western Blot: PLEKHA3 Antibody [NBP1-83924] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: PLEKHA3 Antibody [NBP1-83924] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: PLEKHA3 Antibody [NBP1-83924] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Western Blot: PLEKHA3 Antibody [NBP1-83924] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-436

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLEKHA3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QQVHTIQEFVHHDENHSSPSAENMNEASSLLSATCNTFITTLEECVKIANAKFKPEMFQLHHPDPLVSPVSPSPVQMMKRSVSHP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLEKHA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PLEKHA3 Protein (NBP1-83924PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLEKHA3 Antibody

  • FAPP-1
  • FAPP1PH domain-containing family A member 3
  • FLJ20067
  • four-phosphate-adaptor protein 1
  • Phosphatidylinositol-four-phosphate adapter protein 1
  • Phosphoinositol 4-phosphate adapter protein 1
  • pleckstrin homology domain containing, family A (phosphoinositide bindingspecific) member 3
  • pleckstrin homology domain-containing family A member 3
  • pleckstrin homology domain-containing, family A (phosphoinositide bindingspecific) member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NB300-834
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-00935
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-56440
Species: Hu
Applications: WB
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-04611
Species: Hu
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP2-19020
Species: Hu, Mu, Rt, Po, Bv
Applications: WB
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NB110-96417
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83924
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PLEKHA3 Antibody (NBP1-83924) (0)

There are no publications for PLEKHA3 Antibody (NBP1-83924).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLEKHA3 Antibody (NBP1-83924) (0)

There are no reviews for PLEKHA3 Antibody (NBP1-83924). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PLEKHA3 Antibody (NBP1-83924) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLEKHA3 Products

Bioinformatics Tool for PLEKHA3 Antibody (NBP1-83924)

Discover related pathways, diseases and genes to PLEKHA3 Antibody (NBP1-83924). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLEKHA3 Antibody (NBP1-83924)

Discover more about diseases related to PLEKHA3 Antibody (NBP1-83924).
 

Pathways for PLEKHA3 Antibody (NBP1-83924)

View related products by pathway.

PTMs for PLEKHA3 Antibody (NBP1-83924)

Learn more about PTMs related to PLEKHA3 Antibody (NBP1-83924).

Blogs on PLEKHA3

There are no specific blogs for PLEKHA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLEKHA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLEKHA3