PLBD1 Antibody - BSA Free

Western Blot: PLBD1 Antibody [NBP2-88060] - Host: Rabbit. Target Name: PLBL1. Sample Type: 786-0 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

PLBD1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PLBD1 Antibody - BSA Free (NBP2-88060) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human PLBD1. Peptide sequence: GKVTDTASMKYIMRYNNYKKDPYSRGDPCNTICCREDLNSPNPSPGGCYD The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLBD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for PLBD1 Antibody - BSA Free

• EC 3.1.1
• EC 3.1.1.-
• FLJ22662
• LAMA-like protein 1
• Lamina ancestor homolog 1
• phospholipase B domain containing 1
• Phospholipase B domain-containing protein 1
• PLB homolog 1
• putative phospholipase B-like 1

Background

PLBD1, also known as Phospholipase B-like 1, is a 553 amino acid protein that is 63 kDa, cytoplasmic granule subcellular location, commonly found expressed in neutrophils and monocytes; acts on various phospholipids including phosphatidylcholine, phosphatidylinositol, phosphatidylethanolamine, and lysophospholipids; participates in the generation of lipid mediators of inflammation with an important role in defense against invading microorganisms. This protein has been shown to have interactions with SLC747, IGSF6, TYROBP, and GPCDD1 in pathways such as acyl chain remodeling of PE, acyl chain remodelling of PC, hydrolysis of LPC, phospholipid metabolism, acyl chain remodelling of PI, glycerophospholipid biosynthesis, and metabolism of lipids and lipoproteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLBD1