PLBD1 Antibody - BSA Free

Immunohistochemistry-Paraffin: PLBD1 Antibody [NBP2-37893] - Analysis in human lung and cerebral cortex tissues. Corresponding PLBD1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PLBD1 Antibody [NBP2-37893] - Staining of human liver shows moderate positivity in Kupffer cells.

Immunohistochemistry-Paraffin: PLBD1 Antibody [NBP2-37893] - Staining of human cerebral cortex shows no positivity as expected.

Immunohistochemistry-Paraffin: PLBD1 Antibody [NBP2-37893] - Staining of human rectum shows strong cytoplasmic positivity in lymphoid cells.

Immunohistochemistry-Paraffin: PLBD1 Antibody [NBP2-37893] - Staining of human lung shows strong cytoplasmic positivity in macrophages.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PLBD1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: WMPAEKTVQVKNVMDKNGDAYGFYNNSVKTTGWGILEIRAGYGSQTLSNEIIMFVAGFLEGYLTAPHMNDHYTNLYPQLITKPSIMDKVQDFMEKQD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLBD1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PLBD1 Protein (NBP2-37893PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PLBD1 Antibody - BSA Free

• EC 3.1.1
• EC 3.1.1.-
• FLJ22662
• LAMA-like protein 1
• Lamina ancestor homolog 1
• phospholipase B domain containing 1
• Phospholipase B domain-containing protein 1
• PLB homolog 1
• putative phospholipase B-like 1

Background

PLBD1, also known as Phospholipase B-like 1, is a 553 amino acid protein that is 63 kDa, cytoplasmic granule subcellular location, commonly found expressed in neutrophils and monocytes; acts on various phospholipids including phosphatidylcholine, phosphatidylinositol, phosphatidylethanolamine, and lysophospholipids; participates in the generation of lipid mediators of inflammation with an important role in defense against invading microorganisms. This protein has been shown to have interactions with SLC747, IGSF6, TYROBP, and GPCDD1 in pathways such as acyl chain remodeling of PE, acyl chain remodelling of PC, hydrolysis of LPC, phospholipid metabolism, acyl chain remodelling of PI, glycerophospholipid biosynthesis, and metabolism of lipids and lipoproteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLBD1
• Uniprot:
  • Q6P4A8(Human)