PLA2R1 Recombinant Protein Antigen

Images

 
There are currently no images for PLA2R1 Recombinant Protein Antigen (NBP2-52934PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PLA2R1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLA2R1.

Source: E. coli

Amino Acid Sequence: EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PLA2R1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52934.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PLA2R1 Recombinant Protein Antigen

  • 180 kDa secretory phospholipase A2 receptor
  • CLEC13C
  • CLEC13CC-type lectin domain family 13 member C
  • phospholipase A2 receptor 1, 180kDa
  • PLA2G1R
  • PLA2IR
  • PLA2R1
  • PLA2-RM-type receptor
  • PLA2Rphospholipase A2 receptor 1, 180kD
  • secretory phospholipase A2 receptor

Background

Secretory phospholipases A2 (PLA2s) have been purified from a variety of mammalian tissues as well as from insect and snake venoms. The prototype group I PLA2, the pancreatic PLA2 (PLA2G1B; MIM 172410), is involved in digestion, smooth muscle contraction, and cell proliferation. The prototype group II PLA2, the inflammatory-type PLA2 (PLA2G2A; MIM 172411), is involved in inflammatory conditions and is upregulated by proinflammatory cytokines like tumor necrosis factor (TNF; MIM 191160) and interleukin-1 (e.g., IL1B; MIM 147720). Differential toxicity of snake venom Pla2 appears to be linked to a variety of high-affinity receptors in different organs (Ancian et al., 1995 (PubMed 7721806)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5018
Species: Hu
Applications: IP, WB
AF4925
Species: Mu
Applications: IHC, Simple Western, WB
NBP3-41287
Species: Hu
Applications: IHC,  IHC-P, WB
H00151056-B01P
Species: Hu, Mu
Applications: WB
MAB2669
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-88899
Species: Hu
Applications: IHC,  IHC-P
NBP2-94062
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-46465
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP1-59069
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
NBP1-31344
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA

Publications for PLA2R1 Recombinant Protein Antigen (NBP2-52934PEP) (0)

There are no publications for PLA2R1 Recombinant Protein Antigen (NBP2-52934PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLA2R1 Recombinant Protein Antigen (NBP2-52934PEP) (0)

There are no reviews for PLA2R1 Recombinant Protein Antigen (NBP2-52934PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PLA2R1 Recombinant Protein Antigen (NBP2-52934PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PLA2R1 Products

Blogs on PLA2R1

There are no specific blogs for PLA2R1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PLA2R1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PLA2R1