Recombinant Human PLA2G6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PLA2G6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 151-250 of Human PLA2G6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PLA2G6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PLA2G6 Protein

  • calcium-independent phospholipase A2
  • EC 3.1.1.4
  • Group VI phospholipase A2
  • IPLA2
  • iPLA285 kDa calcium-independent phospholipase A2
  • IPLA2-VIA
  • NBIA2A
  • NBIA2B
  • PARK14GVI
  • patatin-like phospholipase domain containing 9
  • phospholipase A2, group VI (cytosolic, calcium-independent)
  • PNPLA9

Background

The protein encoded by this gene is an A2 phospholipase, a class of enzyme that catalyzes the release of fatty acids from phospholipids. The encoded protein may play a role in phospholipid remodelling, arachidonic acid release, leukotriene and prostaglandin synthesis, fas-mediated apoptosis, and transmembrane ion flux in glucose-stimulated B-cells. Several transcript variants encoding multiple isoforms have been described, but the full-length nature of only two of them have been determined to date. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5018
Species: Hu
Applications: WB, IP
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
AF4925
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-19809
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
AF2364
Species: Hu
Applications: WB, IHC
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008399-D01P
Species: Hu, Rt
Applications: WB
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00008398-Q02
Species: Hu
Applications: WB, ELISA, PA

Publications for PLA2G6 Partial Recombinant Protein (H00008398-Q02) (0)

There are no publications for PLA2G6 Partial Recombinant Protein (H00008398-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLA2G6 Partial Recombinant Protein (H00008398-Q02) (0)

There are no reviews for PLA2G6 Partial Recombinant Protein (H00008398-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLA2G6 Partial Recombinant Protein (H00008398-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PLA2G6 Products

Bioinformatics Tool for PLA2G6 Partial Recombinant Protein (H00008398-Q02)

Discover related pathways, diseases and genes to PLA2G6 Partial Recombinant Protein (H00008398-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLA2G6 Partial Recombinant Protein (H00008398-Q02)

Discover more about diseases related to PLA2G6 Partial Recombinant Protein (H00008398-Q02).
 

Pathways for PLA2G6 Partial Recombinant Protein (H00008398-Q02)

View related products by pathway.

PTMs for PLA2G6 Partial Recombinant Protein (H00008398-Q02)

Learn more about PTMs related to PLA2G6 Partial Recombinant Protein (H00008398-Q02).

Blogs on PLA2G6

There are no specific blogs for PLA2G6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PLA2G6 Antibody
NBP1-81586

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PLA2G6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PLA2G6