PLA2G3 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

PLA2G3 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLA2G3.
  
  

  Source: E. coli

  Amino Acid Sequence: SPPEVTNMLWELLGTTCFKLAPPLDCVEGKNCSRDPRAIRVSARHLRRLQQRRHQLQDKGTDERQPWPSEPLRGPMSFYNQCLQLTQAARRPDRQQKSWSQ

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PLA2G3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83367.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PLA2G3 Recombinant Protein Antigen

• EC 3.1.1.4
• GIII SPLA2
• GIII-SPLA2
• group 3 secretory phospholipase A2
• group III secreted phospholipase A2
• Group III secretory phospholipase A2
• Phosphatidylcholine 2-acylhydrolase 3
• phosphatidylcholine 2-acylhydrolase GIII
• phospholipase A2, group III
• PLA2G3
• SPLA2III
• SPLA2-III

Background

PLA2G3 belongs to the family of secreted phospholipase A2 (sPLA2; EC 3.1.1.4) proteins. These Ca(2+)-dependent lipolytic enzymes have a conserved Ca(2+)-binding loop and a his-asp dyad in the catalytic site (Murakami et al., 2003 [PubMed 12522102]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: PLA2G3