Recombinant Human PLA2G3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PLA2G3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 21-130 of Human PLA2G3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SPALRWYRTSCHLTKAVPGNPLGYLSFLAKDAQGLALIHARWDAHRRLQACSWEDEPELTAAYGALCAHETAWGSFIHTPGPELQRALATLQSQWEACRALEESPAGARK

Protein/Peptide Type
Partial Recombinant Protein
Gene
PLA2G3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PLA2G3 Protein

  • EC 3.1.1.4
  • GIII sPLA2
  • GIII-SPLA2
  • group 3 secretory phospholipase A2
  • group III secreted phospholipase A2
  • Group III secretory phospholipase A2
  • Phosphatidylcholine 2-acylhydrolase 3
  • phosphatidylcholine 2-acylhydrolase GIII
  • phospholipase A2, group III
  • SPLA2III
  • sPLA2-III

Background

PLA2G3 - phospholipase A2, group III

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4925
Species: Mu
Applications: WB, Simple Western, IHC
MAB5018
Species: Hu
Applications: WB, IP
H00008399-D01P
Species: Hu, Rt
Applications: WB
NBP1-81586
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31558
Species: Hu
Applications: WB, IHC, IHC-P
H00064600-R01
Species: Hu
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31685
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38042
Species: Hu
Applications: IHC, IHC-P
NBP2-37255
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
AF1384
Species: Hu
Applications: WB, IHC, ICC
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB500-201
Species: Hu, Mu, Rt, Ca, Fe, GP, Ha
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00050487-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for PLA2G3 Partial Recombinant Protein (H00050487-Q01) (0)

There are no publications for PLA2G3 Partial Recombinant Protein (H00050487-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLA2G3 Partial Recombinant Protein (H00050487-Q01) (0)

There are no reviews for PLA2G3 Partial Recombinant Protein (H00050487-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLA2G3 Partial Recombinant Protein (H00050487-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PLA2G3 Products

Bioinformatics Tool for PLA2G3 Partial Recombinant Protein (H00050487-Q01)

Discover related pathways, diseases and genes to PLA2G3 Partial Recombinant Protein (H00050487-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLA2G3 Partial Recombinant Protein (H00050487-Q01)

Discover more about diseases related to PLA2G3 Partial Recombinant Protein (H00050487-Q01).
 

Pathways for PLA2G3 Partial Recombinant Protein (H00050487-Q01)

View related products by pathway.

Research Areas for PLA2G3 Partial Recombinant Protein (H00050487-Q01)

Find related products by research area.

Blogs on PLA2G3

There are no specific blogs for PLA2G3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PLA2G3 Antibody
NBP1-83367

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PLA2G3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PLA2G3