PLA2G1B Antibody (1B3)

Images

 
Sandwich ELISA: PLA2G1B Antibody (1B3) [H00005319-M01] - Detection limit for recombinant GST tagged PLA2G1B is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1B3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PLA2G1B Antibody (1B3) Summary

Immunogen
PLA2G1B (AAH05386, 17 a.a. - 70 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKQKQRV
Specificity
PLA2G1B (1B3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PLA2G1B
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PLA2G1B Antibody (1B3)

  • Group IB phospholipase A2
  • Phosphatidylcholine 2-acylhydrolase 1B
  • phospholipase A2
  • phospholipase A2, group IB (pancreas)
  • PLA2
  • PLA2A
  • PLA2AMGC119834
  • PLA2EC 3.1.1.4
  • PLA2G1B
  • PPLA2
  • PPLA2MGC119835

Background

Phospholipase A2 (EC 3.1.1.4) catalyzes the release of fatty acids from glycero-3-phosphocholines. The best known varieties are the digestive enzymes secreted as zymogens by the pancreas of mammals. Sequences of pancreatic PLA2 enzymes from a variety of mammals have been reported. One striking feature of these enzymes is their close homology to venom phospholipases of snakes. Other forms of PLA2 have been isolated from brain, liver, lung, spleen, intestine, macrophages, leukocytes, erythrocytes, inflammatory exudates, chondrocytes, and platelets (Seilhamer et al., 1986 [PubMed 3028739]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
AF4925
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19809
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
AF2364
Species: Hu
Applications: WB, IHC
NBP2-24613
Species: Hu
Applications: WB, Simple Western, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00008399-D01P
Species: Hu, Rt
Applications: WB
NBP1-81586
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-58748
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PLA2G1B Antibody (H00005319-M01) (0)

There are no publications for PLA2G1B Antibody (H00005319-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLA2G1B Antibody (H00005319-M01) (0)

There are no reviews for PLA2G1B Antibody (H00005319-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLA2G1B Antibody (H00005319-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLA2G1B Products

Bioinformatics Tool for PLA2G1B Antibody (H00005319-M01)

Discover related pathways, diseases and genes to PLA2G1B Antibody (H00005319-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLA2G1B Antibody (H00005319-M01)

Discover more about diseases related to PLA2G1B Antibody (H00005319-M01).
 

Pathways for PLA2G1B Antibody (H00005319-M01)

View related products by pathway.

PTMs for PLA2G1B Antibody (H00005319-M01)

Learn more about PTMs related to PLA2G1B Antibody (H00005319-M01).
 

Research Areas for PLA2G1B Antibody (H00005319-M01)

Find related products by research area.

Blogs on PLA2G1B

There are no specific blogs for PLA2G1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLA2G1B Antibody (1B3) and receive a gift card or discount.

Bioinformatics

Gene Symbol PLA2G1B
Entrez
OMIM
Uniprot