Recombinant Human PIWIL1/HIWI Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PIWIL1/HIWI Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 431-541 of Human PIWIL1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVDDRTEAY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PIWIL1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PIWIL1/HIWI Protein

  • HIWI
  • HIWIpiwi homolog
  • MIWI
  • piwi (Drosophila)-like 1
  • PIWI
  • PIWIL1
  • piwi-like 1 (Drosophila)
  • piwi-like protein 1

Background

This gene encodes a member of the PIWI subfamily of Argonaute proteins, evolutionarily conserved proteins containing both PAZ and Piwi motifs that play important roles in stem cell self-renewal, RNA silencing, and translational regulation in diverse organisms. The encoded protein may play a role as an intrinsic regulator of the self-renewal capacity of germline and hematopoietic stem cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24590
Species: Mu
Applications: WB, IHC-P
NBP2-37398
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NB100-2817
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
AF2030
Species: Hu
Applications: WB, IHC
NBP2-13951
Species: Hu
Applications: IHC, IHC-P
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-06520
Species: Hu, Mu
Applications: WB, IP
AF6296
Species: Hu
Applications: WB
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31855
Species: Hu
Applications: Simple Western, IHC, IHC-P
NBP1-87892
Species: Hu
Applications: IHC, IHC-P
H00004807-T01
Species: Hu
NBP1-47790
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-03349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-57022
Species: Hu
Applications: WB, ICC/IF
38150002
Species: Hu
Applications: WB, ELISA
NB110-40623
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
H00009457-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-32620
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PIWIL1/HIWI Partial Recombinant Protein (H00009271-Q01) (0)

There are no publications for PIWIL1/HIWI Partial Recombinant Protein (H00009271-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIWIL1/HIWI Partial Recombinant Protein (H00009271-Q01) (0)

There are no reviews for PIWIL1/HIWI Partial Recombinant Protein (H00009271-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIWIL1/HIWI Partial Recombinant Protein (H00009271-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PIWIL1/HIWI Products

Bioinformatics Tool for PIWIL1/HIWI Partial Recombinant Protein (H00009271-Q01)

Discover related pathways, diseases and genes to PIWIL1/HIWI Partial Recombinant Protein (H00009271-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIWIL1/HIWI Partial Recombinant Protein (H00009271-Q01)

Discover more about diseases related to PIWIL1/HIWI Partial Recombinant Protein (H00009271-Q01).
 

Pathways for PIWIL1/HIWI Partial Recombinant Protein (H00009271-Q01)

View related products by pathway.

PTMs for PIWIL1/HIWI Partial Recombinant Protein (H00009271-Q01)

Learn more about PTMs related to PIWIL1/HIWI Partial Recombinant Protein (H00009271-Q01).

Blogs on PIWIL1/HIWI

There are no specific blogs for PIWIL1/HIWI, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PIWIL1/HIWI Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PIWIL1
Entrez