PIWIL1/HIWI Antibody

Immunohistochemistry-Paraffin: PIWIL1/HIWI Antibody [NBP2-33882] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: PIWIL1/HIWI Antibody [NBP2-33882] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: PIWIL1/HIWI Antibody [NBP2-33882] - Staining in human testis and endometrium tissues using anti-PIWIL1 antibody. Corresponding PIWIL1 RNA-seq data are presented for the same tissues.

Product Discontinued

PIWIL1/HIWI Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPL
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIWIL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PIWIL1/HIWI Antibody

• HIWI
• HIWIpiwi homolog
• MIWI
• piwi (Drosophila)-like 1
• PIWI
• PIWIL1
• piwi-like 1 (Drosophila)
• piwi-like protein 1

Background

The PIWIL1 gene encodes a member of the PIWI subfamily of Argonaute proteins, evolutionarily conserved proteins containing both PAZ and Piwi motifs that play important roles in stem cell self-renewal, RNA silencing, and translational regulation in diverse organ

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIWIL1
• Uniprot:
  • Q96J94()