PISD Recombinant Protein Antigen

Images

 
There are currently no images for PISD Protein (NBP1-84212PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PISD Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PISD.

Source: E. coli

Amino Acid Sequence: YKSVPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQARPVCGLHSISPSD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PISD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84212.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PISD Recombinant Protein Antigen

  • DJ858B16
  • dJ858B16.2
  • DKFZp566G2246
  • EC 4.1.1.65
  • phosphatidylserine decarboxylase proenzyme
  • phosphatidylserine decarboxylase
  • PSD
  • PSDC
  • PSSC

Background

PISD, also referred to as Phosphatidylserine Decarboxylase proenzyme, is cleaved into two mature subunits called Phosphatidylserine decarboxylase alpha chain and Phosphatidylserine decarboxylase beta chain. The PISD proenzyme contains a LGST motif that is an autocatalytic cleavage site where it splits into the alpha chain and beta chain. PISD is part of the phosphatidylserine decarboxylase family and localizes to the mitochondrion. Current research on PISD is being conducted in relation to several diseases and disorders including carcinomas and malaria. Research has shown that PISD interacts with PMM2, SGPL1, DHX29, CRLS1 and NAPEPLD in pathways such as the FOXA1 transcription factor network, the metabolism of lipids and lipoproteins and glycerophospholipid metabolism.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-12913
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NB300-106
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
NBP2-00594
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-105
Species: Hu, Mu, Rb, Rt
Applications: IHC,  IHC-P, IP, KO, WB
MPTX20
Species: Mu
Applications: ELISA
H00004068-M01
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NB600-1229
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, Simple Western, WB
NBP1-44999
Species: Hu, Mu
Applications: ICC/IF, WB

Publications for PISD Protein (NBP1-84212PEP) (0)

There are no publications for PISD Protein (NBP1-84212PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PISD Protein (NBP1-84212PEP) (0)

There are no reviews for PISD Protein (NBP1-84212PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PISD Protein (NBP1-84212PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PISD Products

Array NBP1-84212PEP

Research Areas for PISD Protein (NBP1-84212PEP)

Find related products by research area.

Blogs on PISD

There are no specific blogs for PISD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PISD Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PISD