PIN4 Antibody

Product Discontinued

PIN4 Antibody Summary

• Immunogen: Synthetic peptides corresponding to PIN4(protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin)) The peptide sequence was selected from the N terminal of PIN4. Peptide sequence MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGG The peptide sequence for this immunogen was taken from within the described region.
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PIN4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against PIN4 and was validated on Western blot.
• Theoretical MW: 16 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified
• Reconstitution Instructions: Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PIN4 Antibody

• 4 (parvulin)
• MGC138486
• Parvulin-17
• protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin)

Background

This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle, chromatin remodeling, and/or ri

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PIN4
• Uniprot:
  • Q9Y237-2(Human)