PIN4 Antibody

Images

 
Western Blot: PIN4 Antibody [NBP1-52994] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
LYOPH

Order Details

PIN4 Antibody Summary

Immunogen
Synthetic peptides corresponding to PIN4(protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin)) The peptide sequence was selected from the N terminal of PIN4. Peptide sequence MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIN4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PIN4 and was validated on Western blot.
Theoretical MW
16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
LYOPH
Purity
Immunogen affinity purified
Reconstitution Instructions
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PIN4 Antibody

  • 4 (parvulin)
  • MGC138486
  • Parvulin-17
  • protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin)

Background

This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle, chromatin remodeling, and/or ri

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7670
Species: Hu
Applications: WB, ICC
MAB2294
Species: Hu, Mu
Applications: WB, IHC, IP
NBP1-97946
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB110-68281
Species: Hu, Mu, Rt, Mk
Applications: ICC/IF (-), WB, Simple Western, ELISA, Flow
NBP2-57062
Species: Hu
Applications: WB, ICC/IF
NBP1-88766
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14016
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85921
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13794
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38905
Species: Hu
Applications: WB, IHC, IHC-P
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-87929
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4174
Species: Hu, Mu, Rt
Applications: WB, Simple Western
MAB3777
Species: Hu, Mu, Rt
Applications: WB
NBP1-85360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83889
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83887
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for PIN4 Antibody (NBP1-52994) (0)

There are no publications for PIN4 Antibody (NBP1-52994).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PIN4 Antibody (NBP1-52994) (0)

There are no reviews for PIN4 Antibody (NBP1-52994). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PIN4 Antibody (NBP1-52994) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PIN4 Products

Bioinformatics Tool for PIN4 Antibody (NBP1-52994)

Discover related pathways, diseases and genes to PIN4 Antibody (NBP1-52994). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIN4 Antibody (NBP1-52994)

Discover more about diseases related to PIN4 Antibody (NBP1-52994).
 

Pathways for PIN4 Antibody (NBP1-52994)

View related products by pathway.

PTMs for PIN4 Antibody (NBP1-52994)

Learn more about PTMs related to PIN4 Antibody (NBP1-52994).

Blogs on PIN4

There are no specific blogs for PIN4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PIN4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PIN4
Uniprot