Recombinant Human PI4KB/PI4KIII beta Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human PI4KB/PI4KIII beta Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 731 - 828 of Human PIK4CB partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GGLDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
PI4KB
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PI4KB/PI4KIII beta Protein

  • DKFZp686O1820
  • EC 2.7.1
  • EC 2.7.1.67
  • FLJ30129
  • phosphatidylinositol 4-kinase, catalytic, beta
  • pi4K92
  • PI4Kbeta
  • PI4K-beta
  • PI4KIIIBETA
  • type III phosphatidylinositol 4-kinase beta
  • wortmannin-sensitive

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-57995
Species: Hu
Applications: ICC/IF
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-00768
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-33280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
H00064746-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-60112
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for PI4KB/PI4KIII beta Partial Recombinant Protein (H00005298-Q01) (0)

There are no publications for PI4KB/PI4KIII beta Partial Recombinant Protein (H00005298-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PI4KB/PI4KIII beta Partial Recombinant Protein (H00005298-Q01) (0)

There are no reviews for PI4KB/PI4KIII beta Partial Recombinant Protein (H00005298-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PI4KB/PI4KIII beta Partial Recombinant Protein (H00005298-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PI4KB/PI4KIII beta Products

Bioinformatics Tool for PI4KB/PI4KIII beta Partial Recombinant Protein (H00005298-Q01)

Discover related pathways, diseases and genes to PI4KB/PI4KIII beta Partial Recombinant Protein (H00005298-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PI4KB/PI4KIII beta Partial Recombinant Protein (H00005298-Q01)

Discover more about diseases related to PI4KB/PI4KIII beta Partial Recombinant Protein (H00005298-Q01).
 

Pathways for PI4KB/PI4KIII beta Partial Recombinant Protein (H00005298-Q01)

View related products by pathway.

Blogs on PI4KB/PI4KIII beta

There are no specific blogs for PI4KB/PI4KIII beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human PI4KB/PI4KIII beta Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PI4KB