Phospholipase C delta 1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Phospholipase C delta 1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLCD1.
  
  

  Source: E. coli

  Amino Acid Sequence: EAFYKMLTQRVEIDRTFAEAAGSGETLSVDQLVTFLQHQQREEAAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGSAFSLAHRRVYQDMGQP

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: PLCD1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87557.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Phospholipase C delta 1 Recombinant Protein Antigen

• 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-1
• EC 3.1.4.11
• Phosphoinositide phospholipase C-delta-1
• Phospholipase C delta 1
• phospholipase C, delta 1
• Phospholipase C-delta-1
• Phospholipase C-III
• PLCD1
• PLC-delta-1
• PLC-III

Background

Phospholipase C delta 1, also known by its gene name PLCD1, has a 756 amino acid long isoform that is approximately 86 kDa and a 777 amino acid long isoform that is approximately 88 kDa. Phospholipase C delta 1 is a member of the phospholipase C family and plays a critical role in the production of intercellular second messenger molecules. Phospholipase C delta 1 is a tumor suppressor and mutations in PLCD1 may be a cause of hereditary leukonychia. Currently research on Phospholipase C delta 1 is related to several diseases and disorders including nail disorders, squamous cell carcinoma, Huntington's disease, Alzheimer's disease, colon carcinoma, breast cancer, esophagitis and hypertension. Phospholipase C delta 1 has also been shown to interact with CALM1, CALM2, CALM3, TGM2 and KPNB1 in pathways such as IGF1R signaling, PKA signaling, sweet taste signaling and CREB Pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: PLCD1