Phospholipase C delta 1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLCD1. Source: E. coli
Amino Acid Sequence: EAFYKMLTQRVEIDRTFAEAAGSGETLSVDQLVTFLQHQQREEAAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGSAFSLAHRRVYQDMGQP Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
PLCD1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87557. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Phospholipase C delta 1 Recombinant Protein Antigen
Background
Phospholipase C delta 1, also known by its gene name PLCD1, has a 756 amino acid long isoform that is approximately 86 kDa and a 777 amino acid long isoform that is approximately 88 kDa. Phospholipase C delta 1 is a member of the phospholipase C family and plays a critical role in the production of intercellular second messenger molecules. Phospholipase C delta 1 is a tumor suppressor and mutations in PLCD1 may be a cause of hereditary leukonychia. Currently research on Phospholipase C delta 1 is related to several diseases and disorders including nail disorders, squamous cell carcinoma, Huntington's disease, Alzheimer's disease, colon carcinoma, breast cancer, esophagitis and hypertension. Phospholipase C delta 1 has also been shown to interact with CALM1, CALM2, CALM3, TGM2 and KPNB1 in pathways such as IGF1R signaling, PKA signaling, sweet taste signaling and CREB Pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Rt
Applications: ICC, IHC, IP, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Publications for Phospholipase C delta 1 Protein (NBP1-87557PEP) (0)
There are no publications for Phospholipase C delta 1 Protein (NBP1-87557PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Phospholipase C delta 1 Protein (NBP1-87557PEP) (0)
There are no reviews for Phospholipase C delta 1 Protein (NBP1-87557PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Phospholipase C delta 1 Protein (NBP1-87557PEP) (0)
Additional Phospholipase C delta 1 Products
Research Areas for Phospholipase C delta 1 Protein (NBP1-87557PEP)
Find related products by research area.
|
Blogs on Phospholipase C delta 1