Phospholipase C delta 1 Recombinant Protein Antigen

Images

 
There are currently no images for Phospholipase C delta 1 Protein (NBP1-87552PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Phospholipase C delta 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLCD1.

Source: E. coli

Amino Acid Sequence: QDDEDLQALLKGSQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMRTPESQLFSIEDIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PLCD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87552.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Phospholipase C delta 1 Recombinant Protein Antigen

  • 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-1
  • EC 3.1.4.11
  • Phosphoinositide phospholipase C-delta-1
  • Phospholipase C delta 1
  • phospholipase C, delta 1
  • Phospholipase C-delta-1
  • Phospholipase C-III
  • PLCD1
  • PLC-delta-1
  • PLC-III

Background

Phospholipase C delta 1, also known by its gene name PLCD1, has a 756 amino acid long isoform that is approximately 86 kDa and a 777 amino acid long isoform that is approximately 88 kDa. Phospholipase C delta 1 is a member of the phospholipase C family and plays a critical role in the production of intercellular second messenger molecules. Phospholipase C delta 1 is a tumor suppressor and mutations in PLCD1 may be a cause of hereditary leukonychia. Currently research on Phospholipase C delta 1 is related to several diseases and disorders including nail disorders, squamous cell carcinoma, Huntington's disease, Alzheimer's disease, colon carcinoma, breast cancer, esophagitis and hypertension. Phospholipase C delta 1 has also been shown to interact with CALM1, CALM2, CALM3, TGM2 and KPNB1 in pathways such as IGF1R signaling, PKA signaling, sweet taste signaling and CREB Pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2364
Species: Hu
Applications: IHC, WB
NBP2-02300
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP2-38220
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-52533
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
NBP3-20228
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-84957
Species: Hu
Applications: IHC,  IHC-P, WB
H00000518-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-32728
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-48674
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
MAB4364
Species: Rt
Applications: ICC, IHC, IP, KO, WB
NBP2-38392
Species: Hu
Applications: IHC,  IHC-P
NBP3-13288
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB

Publications for Phospholipase C delta 1 Protein (NBP1-87552PEP) (0)

There are no publications for Phospholipase C delta 1 Protein (NBP1-87552PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phospholipase C delta 1 Protein (NBP1-87552PEP) (0)

There are no reviews for Phospholipase C delta 1 Protein (NBP1-87552PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Phospholipase C delta 1 Protein (NBP1-87552PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Phospholipase C delta 1 Products

Research Areas for Phospholipase C delta 1 Protein (NBP1-87552PEP)

Find related products by research area.

Blogs on Phospholipase C delta 1

There are no specific blogs for Phospholipase C delta 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Phospholipase C delta 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PLCD1