PHF23 Antibody

Images

 
Western Blot: PHF23 Antibody [NBP2-13756] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: PHF23 Antibody [NBP2-13756] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PHF23 Antibody [NBP2-13756] - Staining of human rectum shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PHF23 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MATVVGGEAPVPVLPTPPEAPRPPATVHPEGVPPADSESKEVGSTETSQD GDASSSEGEMRVMDEDIMVESGDDSWDLITCYCRKPF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHF23
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PHF23 Protein (NBP2-13756PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PHF23 Antibody

  • FLJ16355
  • FLJ22884
  • hJUNE-1b
  • MGC2941
  • PDH-containing protein JUNE-1
  • PHD finger protein 23
  • PHD finger protein 23a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-40499
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NB100-93325
Species: Hu
Applications: WB, IP
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB6798
Species: Hu
Applications: WB, ICC
NBP2-58069
Species: Hu
Applications: ICC/IF
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-24597
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13756
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PHF23 Antibody (NBP2-13756) (0)

There are no publications for PHF23 Antibody (NBP2-13756).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHF23 Antibody (NBP2-13756) (0)

There are no reviews for PHF23 Antibody (NBP2-13756). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PHF23 Antibody (NBP2-13756) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PHF23 Products

Bioinformatics Tool for PHF23 Antibody (NBP2-13756)

Discover related pathways, diseases and genes to PHF23 Antibody (NBP2-13756). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHF23 Antibody (NBP2-13756)

Discover more about diseases related to PHF23 Antibody (NBP2-13756).
 

Pathways for PHF23 Antibody (NBP2-13756)

View related products by pathway.

PTMs for PHF23 Antibody (NBP2-13756)

Learn more about PTMs related to PHF23 Antibody (NBP2-13756).

Blogs on PHF23

There are no specific blogs for PHF23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHF23 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHF23