PHF15 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of human PHF15. Peptide sequence: MEEKRRKYSISSDNSDTTDSHATSTSASRCSKLPSSTKSGWPRQNEKKPS The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PHF15 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for PHF15 Antibody - BSA Free
Background
PHF15, also known as Protein Jade-2, has 3 isoforms, a 790 amino acid isoform that is 87 kDa, a 789 amino acid isoform that is 87 kDa and a 562 amino acid isoform that is 63 kDa, has a histone H4-specific acetyltransferase activity as a component of the HBO1complex, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. This protein has been shown an interaction with ING4, KAT7, ING5, PACSIN, ZBTB3, ZBTB5, ZNF496, and VHL proteins in histone H3 acetylation, histone H4-K5 acetylation, histone H4-K8 acetylation, and histone H4-K12 acetylation biological processes.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Ca, Dr, Fe, Hu, Mu
Applications: IHC, IHC-P, WB
Publications for PHF15 Antibody (NBP2-88043) (0)
There are no publications for PHF15 Antibody (NBP2-88043).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PHF15 Antibody (NBP2-88043) (0)
There are no reviews for PHF15 Antibody (NBP2-88043).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PHF15 Antibody (NBP2-88043) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PHF15 Products
Blogs on PHF15