PHF11 Antibody

Immunocytochemistry/Immunofluorescence: PHF11 Antibody [NBP2-55029] - Staining of human cell line BJ shows localization to nucleoplasm & nuclear membrane.

Product Discontinued

PHF11 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LYSSGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLKCKFCHKRGATVGCDLKNCNKNYHFFCAKKDDAVPQSDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRGRKKPLS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PHF11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PHF11 Recombinant Protein Antigen (NBP2-55029PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PHF11 Antibody

• APY
• BCAPIGHER
• BRCA1 C-terminus-associated protein
• IgE responsiveness (atopic)
• IGEL
• IGER
• NY-REN-34 antigen
• NYREN34
• NY-REN-34
• PHD finger protein 11
• Renal carcinoma antigen NY-REN-34

Background

These antibodies are affinity purified using their peptide immunogen and are known to give low background staining in a western blot (see Application Notes below). However no additional claims are made for their ability to recognize native protein in any application.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PHF11