PHF11 Antibody

Images

 
Immunohistochemistry-Paraffin: PHF11 Antibody [NBP1-88684] - Staining of human kidney shows strong positivity in tubules as well as glomeruli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PHF11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DATVKVPFLKKCKEAGLLNYLLEEILDKVHSIPEKLMDETTSESDYEEIGSALFDCRLFEDTFVNFQAAIEKKIHASQQRWQQLKEEIELLQDLKQTLCSFQENRDLMSSSTSISSLSY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHF11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
PHF11 Protein (NBP1-88684PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PHF11 Antibody

  • APY
  • BCAPIGHER
  • BRCA1 C-terminus-associated protein
  • IgE responsiveness (atopic)
  • IGEL
  • IGER
  • NY-REN-34 antigen
  • NYREN34
  • NY-REN-34
  • PHD finger protein 11
  • Renal carcinoma antigen NY-REN-34

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01249
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB5565
Species: Hu
Applications: IP, CyTOF-ready, ICFlow
NBP1-91966
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03109
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-470
Species: Hu
Applications: ELISA, Flow
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP1-90509
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1137
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA

Publications for PHF11 Antibody (NBP1-88684) (0)

There are no publications for PHF11 Antibody (NBP1-88684).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PHF11 Antibody (NBP1-88684) (0)

There are no reviews for PHF11 Antibody (NBP1-88684). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PHF11 Antibody (NBP1-88684) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PHF11 Products

Bioinformatics Tool for PHF11 Antibody (NBP1-88684)

Discover related pathways, diseases and genes to PHF11 Antibody (NBP1-88684). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHF11 Antibody (NBP1-88684)

Discover more about diseases related to PHF11 Antibody (NBP1-88684).
 

Pathways for PHF11 Antibody (NBP1-88684)

View related products by pathway.

Blogs on PHF11

There are no specific blogs for PHF11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHF11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHF11
Entrez
Uniprot