PHACTR3 Antibody (4A5) - Azide and BSA Free

Western Blot: PHACTR3 Antibody (4A5) [H00116154-M02] - Analysis of PHACTR3 expression in transfected 293T cell line by PHACTR3 monoclonal antibody (M02), clone 4A5.Lane 1: PHACTR3 transfected lysate(51.5 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: PHACTR3 Antibody (4A5) [H00116154-M02] - Detection limit for recombinant GST tagged PHACTR3 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4A5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

PHACTR3 Antibody (4A5) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse PHACTR3 Antibody (4A5) - Azide and BSA Free (H00116154-M02) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: PHACTR3 (NP_542403.1, 92 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TSALEKKMAGRQGREELIKKGLLEMMEQDAESKTCNPDGGPRSVQSEPPTPKSETLTSEDAQPGSPLATGTDQVSLDKPLSSAAHLDD
• Specificity: PHACTR3 - phosphatase and actin regulator 3 (4A5)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: PHACTR3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PHACTR3 Antibody (4A5) - Azide and BSA Free

• C20orf101
• chromosome 20 open reading frame 101
• H17739
• MGC117178
• phosphatase and actin regulator 3
• scaffold-associated PP1 inhibiting protein
• Scaffold-associated PP1-inhibiting protein
• SCAPIN1
• SCAPININ

Background

The protein encoded by this gene is associated with the nuclear scaffold in proliferating cells. It was found to bind to the catalytic subunit of protein phosphatase-1 (PP1) and inhibit PP1 activity, suggesting that this protein may function as a regulatory subunit of PP1. Alternative splicing at this locus results in several transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PHACTR3
• Entrez:
  • 116154(Human)
• Uniprot:
  • NP_542403(Human)