Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (3B7) Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
PDK1 (AAH39158 203 a.a. - 302 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQ |
| Specificity |
PDK1 - pyruvate dehydrogenase kinase, isoenzyme 1 |
| Isotype |
IgG2b Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
PDK1 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (3B7)
Background
Pyruvate dehydrogenase kinase isoform 1 (PDK1) is a component of the mitochondrial multienzyme complex (PHD) which is responsible for carbohydrate fuel regulation. PDK1 inhbits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.
PDK1 antibodies are useful tools for glucose metabolism research and mitochondrial metabolism studies.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Publications for Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (H00005163-M01) (0)
There are no publications for Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (H00005163-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (H00005163-M01) (0)
There are no reviews for Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (H00005163-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (H00005163-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Pyruvate Dehydrogenase Kinase 1/PDK1 Products
Research Areas for Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (H00005163-M01)
Find related products by research area.
|
Blogs on Pyruvate Dehydrogenase Kinase 1/PDK1