PDK-1 Antibody (3B7)

Images

 
ELISA: PDK1 Antibody (3B7) [H00005163-M01] - Detection limit for recombinant GST tagged PDK1 is approximately 30ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
3B7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PDK-1 Antibody (3B7) Summary

Immunogen
PDK1 (AAH39158 203 a.a. - 302 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQ
Specificity
PDK1 - pyruvate dehydrogenase kinase, isoenzyme 1
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PDK1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PDK-1 Antibody (3B7)

  • [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1, mitochondrial
  • EC 2.7.11
  • EC 2.7.11.2
  • mitochondrial pyruvate dehydrogenase, lipoamide, kinase isoenzyme 1
  • PDK1
  • PDK-1
  • PDPK1
  • PKB kinase
  • Pyruvate dehydrogenase kinase isoform 1
  • pyruvate dehydrogenase kinase, isoenzyme 1
  • pyruvate dehydrogenase kinase, isozyme 1

Background

Pyruvate dehydrogenase (PDH) is a mitochondrial multienzyme complex that catalyzes the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. The enzymatic activity is regulated by a phosphorylation/dephosphorylation cycle. Phosphorylation of PDH by a specific pyruvate dehydrogenase kinase (PDK) results in inactivation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-19010
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
MAB864
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB79671
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00005163-M01
Species: Hu
Applications: ELISA

Publications for PDK-1 Antibody (H00005163-M01) (0)

There are no publications for PDK-1 Antibody (H00005163-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDK-1 Antibody (H00005163-M01) (0)

There are no reviews for PDK-1 Antibody (H00005163-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PDK-1 Antibody (H00005163-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDK-1 Products

Bioinformatics Tool for PDK-1 Antibody (H00005163-M01)

Discover related pathways, diseases and genes to PDK-1 Antibody (H00005163-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDK-1 Antibody (H00005163-M01)

Discover more about diseases related to PDK-1 Antibody (H00005163-M01).
 

Pathways for PDK-1 Antibody (H00005163-M01)

View related products by pathway.

PTMs for PDK-1 Antibody (H00005163-M01)

Learn more about PTMs related to PDK-1 Antibody (H00005163-M01).
 

Research Areas for PDK-1 Antibody (H00005163-M01)

Find related products by research area.

Blogs on PDK-1

There are no specific blogs for PDK-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDK-1 Antibody (3B7) and receive a gift card or discount.

Bioinformatics

Gene Symbol PDK1
Entrez
OMIM
Uniprot