Home » PDE5A » PDE5A Antibodies » PDE5A Antibody (9H5)

PDE5A Antibody (9H5)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: PDE5A Antibody (9H5) [H00008654-M01] - Analysis of monoclonal antibody to PDE5A on HeLa cell. Antibody concentration 20 ug/ml.
Immunocytochemistry/ Immunofluorescence: PDE5A Antibody (9H5) [H00008654-M01] - Analysis of monoclonal antibody to PDE5A on HeLa cell. Antibody concentration 20 ug/ml.
Sandwich ELISA: PDE5A Antibody (9H5) [H00008654-M01] - Detection limit for recombinant GST tagged PDE5A is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, PlSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-Fr, S-ELISA
Clone
9H5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

PDE5A Antibody (9H5) Summary

Immunogen
PDE5A (NP_001074, 29 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVHTIPVCKEGIRGHTESCSCPLQQSPRADNSVPGTPTRKISASEFDRPLRPIVVKDSEGTVSFLSDSEKKEQMPLTP
Specificity
PDE5A - phosphodiesterase 5A, cGMP-specific
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PDE5A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00008654-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PDE5A Antibody (9H5)

  • CGB-PDE
  • cGMP-binding cGMP-specific 3'-5'-cyclic nucleotide phosphodiesterase
  • cGMP-binding cGMP-specific phosphodiesterase
  • cGMP-specific 3'-5'-cyclic phosphodiesterase
  • cGMP-specific phosphodiesterase type 5A
  • CN5A
  • EC 3.1.4
  • EC 3.1.4.35
  • PDE5
  • phosphodiesterase 5A, cGMP-specific
  • phosphodiesterase isozyme 5

Background

This gene encodes a cGMP-binding, cGMP-specific phosphodiesterase, a member of the cyclic nucleotide phosphodiesterase family. This phosphodiesterase specifically hydrolyzes cGMP to 5'-GMP. It is involved in the regulation of intracellular concentrations of cyclic nucleotides and is important for smooth muscle relaxation in the cardiovascular system. Alternative splicing of this gene results in three transcript variants encoding distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ALDH7A1 Antibody
NBP1-88908
Western Blot: ALDH7A1 Antibody [NBP1-88908] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue
Immunocytochemistry/Immunofluorescence: ALDH7A1 Antibody [NBP1-88908] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ALDH7A1 Antibody [NBP1-88908] - Staining of human liver shows moderate positivity in cytoplasm granular in hepatocytes.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Phosphodiesterase
4A/PDE4A Antibody (OT ...
NBP2-02559
Western Blot: Phosphodiesterase 4A/PDE4A Antibody (1C8) [NBP2-02559] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PDE4A (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PDE4A.
Immunocytochemistry/Immunofluorescence: Phosphodiesterase 4A/PDE4A Antibody (1C8) [NBP2-02559] - Immunofluorescent staining of HT29 cells using anti-PDE4A mouse monoclonal antibody.
Immunohistochemistry-Paraffin: Phosphodiesterase 4A/PDE4A Antibody (1C8) [NBP2-02559] - Staining of paraffin-embedded Human prostate tissue using anti-PDE4A mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
cGK1/PRKG1 Antibody
NBP2-14843
Western Blot: cGK1/PRKG1 Antibody [NBP2-14843] - Lane 1: MW marker, Lane 2: HeLa cell lysate, Lane 3: Rat brain tissue extract, Lane 4: MDBK cell lysate.
(1 Review)
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P, IP
iNOS Antibody
NB300-605
Western Blot: iNOS Antibody [NB300-605] - Analysis of iNOS was performed by loading 20 ug of RAW264 whole cell lysate untreated (left lane) or stimulated with LPS at 1 ug/mL for 16 hours (right lane) and 10 uL of PageRuler Plus Prestained Protein Ladder onto a 4-20% Tris-Glycine polyacrylamide gel. Proteins were transferred to a nitrocellulose membrane and blocked with 5% Milk in TBST for at least 1 hour. The membrane was probed with an iNOS Rabbit polyclonal antibody at a dilution of 1:1000 overnight at 4C on a rocking platform, washed in TBST, and probed with a Goat anti-Rabbit IgG (H+L) Secondary Antibody, HRP conjugate at a dilution of 1:1000 for 1 hour. Chemiluminescent detection was performed using SuperSignal West Pico.
Immunohistochemistry-Paraffin: iNOS Antibody [NB300-605] - Immunohistochemistry was performed on normal deparaffinized human Lung tissue.
Immunohistochemistry-Paraffin: iNOS Antibody [NB300-605] - Immunohistochemistry was performed on normal deparaffinized human Heart tissue.
(3 Reviews)
(56 Publications)
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro
nNOS Antibody
NB100-858
Immunocytochemistry/Immunofluorescence: nNOS Antibody [NB100-858] - Immunofluorescence analysis of paraformaldehyde fixed HeLa cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing membrane, cytoplasmic and nuclear staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Immunohistochemistry: nNOS Antibody [NB100-858] - Immunostaining of NOS1 neurons in cryosection of a perfusion-fixed (4% PFA) mouse caudate-putamen. HRP-staining with Ni-DAB, after Biotin-SP-anti-goat (IgG) method. Scale bar: 50 um; inset: 20 um. Data obtained by Drs. Eva Rumpler and Erik Hrabovszky, Inst, Exp, Med, Budapest, Hungary.
Flow Cytometry: nNOS Antibody [NB100-858] - Flow cytometric analysis of paraformaldehyde fixed Kelly cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(1 Review)
(13 Publications)
Species: Hu, Mu, Rt, Gp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, IHC-WhMt
eNOS Antibody
NB300-500
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Expression of endothelial markers indicate functional endothelium in TEVG. Whole mount staining of native aorta and TEVG. VE-cadherin is a marker of cellular borders of endothelial cells (green). Endothelial nitric oxide synthase (eNOS) is a marker of a functional endothelium (red). DAPI is a nuclear stain (blue). Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0120328), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Staining of eNOS in human lung tissue.
Immunohistochemistry-Paraffin: eNOS Antibody [NB300-500] - Mouse Carotid Artery stained with eNOS antibody. Image from verified customer review.
(3 Reviews)
(17 Publications)
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr, Sh
Applications: WB, IHC, IHC-Fr, IHC-P
PDE3B Antibody
(SMCP3B)
NBP1-43333
Western Blot: PDE3B Antibody (SMCP3B) [NBP1-43333] - Lysates prepared from mouse heart (lane 1) or lymph node cells (lane 2) were run under reducing conditions on a 3-8% Tris-Acetate gel. The membrane was probed with 2 ug/mL of Anti-Mouse PDE3B Purified, followed by Anti-Rat IgG HRP.
(1 Publication)
Species: Mu
Applications: WB
beta Sarcoglycan
Antibody
NBP1-90300
Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining in human heart muscle and pancreas tissues using NBP1-90300 antibody. Corresponding SGCB RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining of human heart muscle shows strong membranous and cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: beta Sarcoglycan Antibody [NBP1-90300] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
(4 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Atrial Natriuretic
Peptide/ANP Antibody
NBP2-14873
Western Blot: Atrial Natriuretic Peptide/ANP Antibody [NBP2-14873] - Knockdown of ATE1 attenuates cardiac hypertrophy. Western blot analysis of ANP protein levels in heart samples from sham and renal ligated rats (B2) bar graph was generated by quantifying the blots and normalizing the intensities of bands to the untreated lane (C) BNP and (D) beta-MHC in Ligated ATE1 siRNA when compared with Ligated NS siRNA samples. Statistical analysis was carried out by one-way ANOVA. Data are represented as mean +/- SE. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-019-57379-7) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Atrial Natriuretic Peptide/ANP Antibody [NBP2-14873] - Mouse heart. ANP stained by ANP antibody [N1C3] diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Western Blot: Atrial Natriuretic Peptide/ANP Antibody [NBP2-14873] - Rat tissue extract (50 ug) was separated by 15% SDS-PAGE, and the membrane was blotted with ANP antibody [N1C3] diluted at 1:2000.
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
PDE2A Antibody
(OTI3A4)
NBP2-03598
Western Blot: PDE2A Antibody (3A4) [NBP2-03598] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PDE2A (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PDE2A.
Immunocytochemistry/Immunofluorescence: PDE2A Antibody (3A4) [NBP2-03598] Staining of COS7 cells transiently transfected by pCMV6-ENTRY PDE2A.
Immunohistochemistry-Paraffin: PDE2A Antibody (3A4) [NBP2-03598] - Staining of paraffin-embedded Human prostate tissue using anti-PDE2A mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Nanos3 Antibody
NBP1-76919
Western Blot: Nanos3 Antibody [NBP1-76919] - Human brain tissue lysate with Nanos3 antibody at 2 ug/mL.
Immunocytochemistry/Immunofluorescence: Nanos3 Antibody [NBP1-76919] - in Human Brain cells.
Immunohistochemistry-Paraffin: Nanos3 Antibody [NBP1-76919] - Human brain tissue with Nanos3 antibody at 2.5 ug/ml.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
ISYNA1 Antibody
NBP2-47415
Western Blot: ISYNA1 Antibody [NBP2-47415] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line HEK 293
Immunocytochemistry/Immunofluorescence: ISYNA1 Antibody [NBP2-47415] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: ISYNA1 Antibody [NBP2-47415] - Staining of human placenta.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PDE5A Antibody (H00008654-M01)(1)


Reviews for PDE5A Antibody (H00008654-M01) (0)

There are no reviews for PDE5A Antibody (H00008654-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PDE5A Antibody (H00008654-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional PDE5A Products

Bioinformatics Tool for PDE5A Antibody (H00008654-M01)

Discover related pathways, diseases and genes to PDE5A Antibody (H00008654-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDE5A Antibody (H00008654-M01)

Discover more about diseases related to PDE5A Antibody (H00008654-M01).
 

Pathways for PDE5A Antibody (H00008654-M01)

View related products by pathway.

PTMs for PDE5A Antibody (H00008654-M01)

Learn more about PTMs related to PDE5A Antibody (H00008654-M01).
 

Research Areas for PDE5A Antibody (H00008654-M01)

Find related products by research area.

Blogs on PDE5A

There are no specific blogs for PDE5A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDE5A Antibody (9H5) and receive a gift card or discount.


Bioinformatics

Gene Symbol PDE5A
Entrez
OMIM
Uniprot