PDE5A Antibody (1F11)

Images

 
Western Blot: PDE5A Antibody (1F11) [H00008654-M02] - PDE5A monoclonal antibody (M02), clone 1F11. Analysis of PDE5A expression in Jurkat.
Immunocytochemistry/ Immunofluorescence: PDE5A Antibody (1F11) [H00008654-M02] - Analysis of monoclonal antibody to PDE5A on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1F11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PDE5A Antibody (1F11) Summary

Immunogen
PDE5A (NP_001074, 29 a.a. - 138 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVHTIPVCKEGIRGHTESCSCPLQQSPRADNSVPGTPTRKISASEFDRPLRPIVVKDSEGTVSFLSDSEKKEQMPLTP
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PDE5A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PDE5A Antibody (1F11)

  • CGB-PDE
  • cGMP-binding cGMP-specific 3'-5'-cyclic nucleotide phosphodiesterase
  • cGMP-binding cGMP-specific phosphodiesterase
  • cGMP-specific 3'-5'-cyclic phosphodiesterase
  • cGMP-specific phosphodiesterase type 5A
  • CN5A
  • EC 3.1.4
  • EC 3.1.4.35
  • PDE5
  • phosphodiesterase 5A, cGMP-specific
  • phosphodiesterase isozyme 5

Background

This gene encodes a cGMP-binding, cGMP-specific phosphodiesterase, a member of the cyclic nucleotide phosphodiesterase family. This phosphodiesterase specifically hydrolyzes cGMP to 5'-GMP. It is involved in the regulation of intracellular concentrations of cyclic nucleotides and is important for smooth muscle relaxation in the cardiovascular system. Alternative splicing of this gene results in three transcript variants encoding distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15343
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02559
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02521
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-46183
Species: Hu
Applications: WB, IP
NBP1-90300
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-03598
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-76919
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PDE5A Antibody (H00008654-M02) (0)

There are no publications for PDE5A Antibody (H00008654-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDE5A Antibody (H00008654-M02) (0)

There are no reviews for PDE5A Antibody (H00008654-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PDE5A Antibody (H00008654-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDE5A Products

Bioinformatics Tool for PDE5A Antibody (H00008654-M02)

Discover related pathways, diseases and genes to PDE5A Antibody (H00008654-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDE5A Antibody (H00008654-M02)

Discover more about diseases related to PDE5A Antibody (H00008654-M02).
 

Pathways for PDE5A Antibody (H00008654-M02)

View related products by pathway.

PTMs for PDE5A Antibody (H00008654-M02)

Learn more about PTMs related to PDE5A Antibody (H00008654-M02).
 

Research Areas for PDE5A Antibody (H00008654-M02)

Find related products by research area.

Blogs on PDE5A

There are no specific blogs for PDE5A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDE5A Antibody (1F11) and receive a gift card or discount.

Bioinformatics

Gene Symbol PDE5A
Uniprot