![Western Blot: PDCD2L Antibody [H00084306-D01P] - Analysis of PDCD2L expression in transfected 293T cell line by PDCD2L polyclonal antibody.Lane 1: PDCD2L transfected lysate(39.40 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/PDCD2L-Antibody-Western-Blot-H00084306-D01P-img0002.jpg "Western Blot: PDCD2L Antibody [H00084306-D01P] - Analysis of PDCD2L expression in transfected 293T cell line by PDCD2L polyclonal antibody.Lane 1: PDCD2L transfected lysate(39.40 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Rabbit PDCD2L Antibody - Azide and BSA Free (H00084306-D01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | PDCD2L (NP_115722.1, 1 a.a. - 358 a.a.) full-length human protein. MAAVLKPVLLGLRDAPVHGSPTGPGAWTASKLGGIPDALPTVAAPRPVCQRCGQPLALVVQVYCPLEGSPFHRLLHVFACACPGCSTGGARSWKVFRSQCLQVPEREAQDAQKQGNSLAAEDWCEGADDWGSDTEEGPSPQFTLDFGNDASSAKDVDWTARLQDLRLQDAVLGAAHPVPPGLPLFLPYYICVADEDDYRDFVNLDHAHSLLRDYQQREGIAMDQLLSQSLPNDGDEKYEKTIIKSGDQTFYKFMKRIAACQEQILRYSWSGEPLFLTCPTSEVTELPACSQCGGQRIFEFQLMPALVSMLKSANLGLSVEFGTILVYTCEKSCWPPNHQTPMEEFCIIQEDPDELLFK |
| Specificity | PDCD2L - programmed cell death 2-like, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PDCD2L |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against transfected lysate for western blot and recombinant protein with GST tag for ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PDCD2L Antibody (H00084306-D01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PDCD2L |
| Entrez |
|
| Uniprot |
|
![N/A Fas Ligand/TNFSF6 [HRP]](https://images.novusbio.com/images2/Fas_Ligand_DFL00_ELISA_1192.jpg)
![N/A Fas Ligand/TNFSF6 [HRP]](https://images.novusbio.com/images2/Fas_Ligand_DFL00_ELISA_1193.jpg)
![N/A Fas Ligand/TNFSF6 [HRP]](https://images.novusbio.com/images2/DATA_Fas_Ligand_DFL00_ELISA_677.jpg)
![TRAIL/TNFSF10 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "TRAIL/TNFSF10 [Unconjugated]")
![Immunohistochemistry Semaphorin 6A Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1615_mouse-semaphorin-6a-affinity-purified-polyclonal-ab-immunohistochemistry-92202314926.jpg)
![Immunohistochemistry PKC epsilon Antibody [Unconjugated]](https://images.novusbio.com/images2/PKC_epsilon_AF5134_Immunohistochemistry_10291.jpg)
![Western Blot PKC epsilon Antibody [Unconjugated]](https://images.novusbio.com/images2/PKC_epsilon_AF5134_Western_Blot_5640.jpg)
![Western Blot PKC epsilon Antibody [Unconjugated]](https://images.novusbio.com/images2/PKC_epsilon_AF5134_Western_Blot_21540.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")