PCDH7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PCDH7 Antibody [NBP2-58138] - Staining of human cell line U-2 OS shows localization to plasma membrane.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PCDH7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NAPTVTLPKNISYTLLPPSSNVRTVVATVLATDSDDGINADLNYSIVGGNPFKLFEIDPTSGVVSLVGKLTQKHYGLHRLVVQVNDSGQPSQSTTTLVHVFVNESV
Specificity
Specificity of human PCDH7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PCDH7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PCDH7 Recombinant Protein Antigen (NBP2-58138PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PCDH7 Antibody

  • BH-PcdhBHPCDHprotocadherin-7
  • BH-protocadherin (brain-heart)
  • Brain-heart protocadherin
  • protocadherin 7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81410
Species: Hu
Applications: IHC, IHC-P
H00005097-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF7669
Species: Hu, Mu, Rt
Applications: WB
5604-CA
Species: Hu
NBP1-80939
Species: Hu
Applications: IHC, IHC-P
NBP2-61772
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
H00028513-B01P
Species: Hu
Applications: WB, ELISA
6774-CA
Species: Hu
188-C8
Species: Hu
AF5434
Species: Hu
Applications: WB, ICC
H00083259-Q01
Species: Hu
MAB8626
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-77005
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38640
Species: Hu
Applications: IHC, IHC-P
MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-27372
Species: Hu, Mu, Ma
Applications: WB
AF2715
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-06519
Species: Hu
Applications: WB, IHC, IHC-P, IP

Publications for PCDH7 Antibody (NBP2-58138) (0)

There are no publications for PCDH7 Antibody (NBP2-58138).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCDH7 Antibody (NBP2-58138) (0)

There are no reviews for PCDH7 Antibody (NBP2-58138). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PCDH7 Antibody (NBP2-58138) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for PCDH7 Antibody (NBP2-58138)

Discover related pathways, diseases and genes to PCDH7 Antibody (NBP2-58138). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCDH7 Antibody (NBP2-58138)

Discover more about diseases related to PCDH7 Antibody (NBP2-58138).
 

Pathways for PCDH7 Antibody (NBP2-58138)

View related products by pathway.

PTMs for PCDH7 Antibody (NBP2-58138)

Learn more about PTMs related to PCDH7 Antibody (NBP2-58138).

Blogs on PCDH7

There are no specific blogs for PCDH7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCDH7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDH7