PCDH7 Antibody

Images

 
Western Blot: PCDH7 Antibody [H00005099-A01] - Analysis of PCDH7 expression in SJCRH30 (Cat # L027V1).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PCDH7 Antibody Summary

Immunogen
PCDH7 (NP_002580, 31 a.a. - 124 a.a.) partial recombinant protein with GST tag. KQLLRYRLAEEGPADVRIGNVASDLGIVTGSGEVTFSLESGSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPSQSWV
Specificity
PCDH7 - BH-protocadherin (brain-heart)
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
PCDH7
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Whole antisera with 50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PCDH7 Antibody

  • BH-PcdhBHPCDHprotocadherin-7
  • BH-protocadherin (brain-heart)
  • Brain-heart protocadherin
  • protocadherin 7

Background

This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The gene encodes a protein with an extracellular domain containing 7 cadherin repeats. The gene product is an integral membrane protein that is thought to function in cell-cell recognition and adhesion. Alternative splicing yields isoforms with unique cytoplasmic tails.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19719
Species: Hu
Applications: WB, IHC, IHC-P
H00005097-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF7669
Species: Hu, Mu, Rt
Applications: WB
35740002
Species: Hu
Applications: WB, ELISA
NBP1-80939
Species: Hu
Applications: IHC, IHC-P
NBP2-04544
Species: Hu
H00028513-B01P
Species: Hu
Applications: WB, ELISA
6774-CA
Species: Hu
NBP2-58593
Species: Hu
Applications: WB, ICC/IF
AF5434
Species: Hu
Applications: WB, ICC
NBL1-14149
Species: Hu
MAB8626
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-77005
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38640
Species: Hu
Applications: IHC, IHC-P
MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-27372
Species: Hu, Mu, Ma
Applications: WB
AF2715
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP1-06519
Species: Hu
Applications: WB, IHC-P, IP

Publications for PCDH7 Antibody (H00005099-A01) (0)

There are no publications for PCDH7 Antibody (H00005099-A01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCDH7 Antibody (H00005099-A01) (0)

There are no reviews for PCDH7 Antibody (H00005099-A01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PCDH7 Antibody (H00005099-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PCDH7 Products

Bioinformatics Tool for PCDH7 Antibody (H00005099-A01)

Discover related pathways, diseases and genes to PCDH7 Antibody (H00005099-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PCDH7 Antibody (H00005099-A01)

Discover more about diseases related to PCDH7 Antibody (H00005099-A01).
 

Pathways for PCDH7 Antibody (H00005099-A01)

View related products by pathway.

PTMs for PCDH7 Antibody (H00005099-A01)

Learn more about PTMs related to PCDH7 Antibody (H00005099-A01).

Blogs on PCDH7

There are no specific blogs for PCDH7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PCDH7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PCDH7
Entrez
OMIM
Uniprot