![Western Blot: Pbx3 Antibody (1A9) [H00005090-M01] - PBX3 monoclonal antibody (M01), clone 1A9 Analysis of PBX3 expression in Hela S3 NE.](http://images.novusbio.com/fullsize/Pbx3-Antibody-1A9-Western-Blot-H00005090-M01-img0007.jpg "Western Blot: Pbx3 Antibody (1A9) [H00005090-M01] - PBX3 monoclonal antibody (M01), clone 1A9 Analysis of PBX3 expression in Hela S3 NE.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 1A9 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | PBX3 (NP_006186, 342 a.a. ~ 434 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FNLPNSGDMFMNMQSLNGDSYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSSVTSPTEGPGSVHSDTSN |
| Specificity | PBX3 - pre-B-cell leukemia transcription factor 3 |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | PBX3 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00005090-M01 | Applications | Species |
|---|---|---|
| Ramberg H, Grytli HH, Nygard S et al. PBX3 is a putative biomarker of aggressive prostate cancer. Int J Cancer 2016-10-15 [PMID: 27273830] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Pbx3 Antibody (1A9) [H00005090-M01] - Analysis of monoclonal antibody to PBX3 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 0.3 ug/ml.](http://images.novusbio.com/fullsize/Pbx3-Antibody-1A9-Immunohistochemistry-Paraffin-H00005090-M01-img0005.jpg "Immunohistochemistry-Paraffin: Pbx3 Antibody (1A9) [H00005090-M01] - Analysis of monoclonal antibody to PBX3 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 0.3 ug/ml.")
![ELISA: Pbx3 Antibody (1A9) [H00005090-M01] - Detection limit for recombinant GST tagged PBX3 is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Pbx3-Antibody-1A9-ELISA-H00005090-M01-img0008.jpg "ELISA: Pbx3 Antibody (1A9) [H00005090-M01] - Detection limit for recombinant GST tagged PBX3 is approximately 0.03ng/ml as a capture antibody.")
![Western Blot TCF-3/E2A Antibody (826927) [Unconjugated]](https://images.novusbio.com/images2/TCF3_MAB7650_Western_Blot_12841.jpg)
![Immunohistochemistry TCF-3/E2A Antibody (826927) [Unconjugated]](https://images.novusbio.com/images2/TCF3_MAB7650_Immunohistochemistry_12859.jpg)
![Flow Cytometry Flt-3/Flk-2/CD135 Antibody (66903) [Unconjugated]](https://images.novusbio.com/images/antibody/mab812_human-flt-3-flk-2-mab-clone-66903-flow-cytometry-3112023131157..jpg)
![Flow Cytometry Flt-3/Flk-2/CD135 Antibody (66903) [Unconjugated]](https://images.novusbio.com/images/antibody/mab812_human-flt-3-flk-2-mab-clone-66903-flow-cytometry-3112023131255..jpg)
