Pbx3 Antibody (1A9)

Images

 
Western Blot: Pbx3 Antibody (1A9) [H00005090-M01] - PBX3 monoclonal antibody (M01), clone 1A9 Analysis of PBX3 expression in Hela S3 NE.
Immunohistochemistry-Paraffin: Pbx3 Antibody (1A9) [H00005090-M01] - Analysis of monoclonal antibody to PBX3 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 0.3 ug/ml.
Sandwich ELISA: Pbx3 Antibody (1A9) [H00005090-M01] - Detection limit for recombinant GST tagged PBX3 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
1A9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Pbx3 Antibody (1A9) Summary

Immunogen
PBX3 (NP_006186 342 a.a. - 434 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FNLPNSGDMFMNMQSLNGDSYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSSVTSPTEGPGSVHSDTSN
Specificity
PBX3 - pre-B-cell leukemia transcription factor 3
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PBX3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Publications
Read Publication using H00005090-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Pbx3 Antibody (1A9)

  • Homeobox protein PBX3
  • pre-B-cell leukemia homeobox 3
  • pre-B-cell leukemia transcription factor 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-24597
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, IHC-P
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
H00004212-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-19853
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
NB100-81652
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-248
Species: Hu
Applications: WB, IP
2980-PI
Species: Hu
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP1-83235
Species: Hu
Applications: WB, IHC, IHC-P
H00003204-M01
Species: Hu
Applications: WB, ELISA
NBL1-11664
Species: Hu
MAB7650
Species: Mu
Applications: WB, IHC
NBP2-13513
Species: Hu
Applications: WB, AG, ICC/IF, IHC, IHC-P
AF6116
Species: Hu
Applications: WB, ICC
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-03933
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00005090-M01
Species: Hu
Applications: WB, ELISA, IHC-P

Publications for Pbx3 Antibody (H00005090-M01)(1)


Reviews for Pbx3 Antibody (H00005090-M01) (0)

There are no reviews for Pbx3 Antibody (H00005090-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pbx3 Antibody (H00005090-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Pbx3 Antibody (1A9) and receive a gift card or discount.

Bioinformatics

Gene Symbol PBX3
Entrez
OMIM
Uniprot