PARS2 Antibody

Images

 
Western Blot: PARS2 Antibody [NBP1-84105] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: PARS2 Antibody [NBP1-84105] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PARS2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QLPVDIGEDRLAICPRCSFSANMETLDLSQMNCPACQGPLTKTKGIEVGHTFYLGTKYSSIFNAQFTNVCGKPTLAE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PARS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PARS2 Protein (NBP1-84105PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PARS2 Antibody

  • DKFZp727A071
  • EC 6.1.1.15
  • MGC14416
  • MGC19467
  • MT-PRORS
  • probable prolyl-tRNA synthetase, mitochondrial
  • proline tRNA ligase 2, mitochondrial (putative)
  • Proline--tRNA ligase
  • prolyl-tRNA synthetase (mitochondrial)(putative)
  • prolyl-tRNA synthetase 2, mitochondrial (putative)
  • prolyl-tRNA synthetase, mitochondrial (putative)
  • proRS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87706
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86624
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83059
Species: Hu
Applications: IHC, IHC-P
NBP1-57136
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-83854
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85937
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84637
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13640
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20744
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87698
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01425
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-45808
Species: Hu
Applications: IHC
NBP1-91856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13513
Species: Hu
Applications: WB, AG, ICC/IF, IHC, IHC-P
NBP2-49627
Species: Hu
Applications: WB, IHC
NBP1-54653
Species: Hu
Applications: WB
NBP1-82294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF

Publications for PARS2 Antibody (NBP1-84105) (0)

There are no publications for PARS2 Antibody (NBP1-84105).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PARS2 Antibody (NBP1-84105) (0)

There are no reviews for PARS2 Antibody (NBP1-84105). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PARS2 Antibody (NBP1-84105) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PARS2 Products

Bioinformatics Tool for PARS2 Antibody (NBP1-84105)

Discover related pathways, diseases and genes to PARS2 Antibody (NBP1-84105). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PARS2 Antibody (NBP1-84105)

Discover more about diseases related to PARS2 Antibody (NBP1-84105).
 

Pathways for PARS2 Antibody (NBP1-84105)

View related products by pathway.

Research Areas for PARS2 Antibody (NBP1-84105)

Find related products by research area.

Blogs on PARS2

There are no specific blogs for PARS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PARS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PARS2