PABPC5 Antibody

Images

 
Western Blot: PABPC5 Antibody [NBP1-87355] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: PABPC5 Antibody [NBP1-87355] - Staining of human cerebral cortex shows distinct cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PABPC5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EPNPAGKKKKYLKAALYVGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLGYGYVNFRFPADAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFIKNLDKSIDNR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PABPC5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PABPC5 Protein (NBP1-87355PEP)
Publications
Read Publication using NBP1-87355.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PABPC5 Antibody

  • cytoplasmic 5
  • FLJ51677
  • PABP-5
  • poly(A) binding protein, cytoplasmic 5
  • Poly(A)-binding protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7555
Species: Hu
Applications: WB, Simple Western
H00060436-M01
Species: Hu
Applications: WB, ELISA
NBP1-86320
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NB100-74593
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-80939
Species: Hu
Applications: IHC, IHC-P
NBP1-87355
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for PABPC5 Antibody (NBP1-87355)(1)

Reviews for PABPC5 Antibody (NBP1-87355) (0)

There are no reviews for PABPC5 Antibody (NBP1-87355). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PABPC5 Antibody (NBP1-87355) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PABPC5 Products

Bioinformatics Tool for PABPC5 Antibody (NBP1-87355)

Discover related pathways, diseases and genes to PABPC5 Antibody (NBP1-87355). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PABPC5 Antibody (NBP1-87355)

Discover more about diseases related to PABPC5 Antibody (NBP1-87355).

Blogs on PABPC5

There are no specific blogs for PABPC5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PABPC5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PABPC5