p38 delta/SAPK4 Antibody (2B2)

Images

 
Western Blot: p38 delta/SAPK4 Antibody (2B2) [H00005603-M05] - Analysis of MAPK13 expression in A-431 (Cat # L015V1).
Immunocytochemistry/ Immunofluorescence: p38 delta/SAPK4 Antibody (2B2) [H00005603-M05] - Analysis of monoclonal antibody to MAPK13 on A-431 cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: p38 delta/SAPK4 Antibody (2B2) [H00005603-M05] - Analysis of monoclonal antibody to MAPK13 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 1 ug/ml
ELISA: p38 delta/SAPK4 Antibody (2B2) [H00005603-M05] - Detection limit for recombinant GST tagged MAPK13 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
2B2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

p38 delta/SAPK4 Antibody (2B2) Summary

Immunogen
MAPK13 (AAH00433, 251 a.a. - 365 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDRRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL
Specificity
MAPK13 - mitogen-activated protein kinase 13
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAPK13
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for p38 delta/SAPK4 Antibody (2B2)

  • EC 2.7.11
  • EC 2.7.11.24
  • MAP kinase 13
  • MAPK 13
  • MAPK13
  • MGC99536
  • mitogen-activated protein kinase 13
  • Mitogen-activated protein kinase p38 delta
  • p38 delta
  • p38delta
  • PRKM13
  • SAPK4MAP kinase p38 delta
  • Stress-activated protein kinase 4

Background

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and cellular stress. MAP kinase kinases 3, and 6 can phosphorylate and activate this kinase. Transcription factor ATF2, and microtubule dynamics regulator stathmin have been shown to be the substrates of this kinase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NB100-56446
Species: Hu, Mu, Rt
Applications: WB
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-52508
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-82050
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC
H00005603-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for p38 delta/SAPK4 Antibody (H00005603-M05) (0)

There are no publications for p38 delta/SAPK4 Antibody (H00005603-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p38 delta/SAPK4 Antibody (H00005603-M05) (0)

There are no reviews for p38 delta/SAPK4 Antibody (H00005603-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for p38 delta/SAPK4 Antibody (H00005603-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p38 delta/SAPK4 Products

Bioinformatics Tool for p38 delta/SAPK4 Antibody (H00005603-M05)

Discover related pathways, diseases and genes to p38 delta/SAPK4 Antibody (H00005603-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p38 delta/SAPK4 Antibody (H00005603-M05)

Discover more about diseases related to p38 delta/SAPK4 Antibody (H00005603-M05).
 

Pathways for p38 delta/SAPK4 Antibody (H00005603-M05)

View related products by pathway.

PTMs for p38 delta/SAPK4 Antibody (H00005603-M05)

Learn more about PTMs related to p38 delta/SAPK4 Antibody (H00005603-M05).
 

Research Areas for p38 delta/SAPK4 Antibody (H00005603-M05)

Find related products by research area.

Blogs on p38 delta/SAPK4

There are no specific blogs for p38 delta/SAPK4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p38 delta/SAPK4 Antibody (2B2) and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPK13
Entrez
OMIM
Uniprot