p38 delta/SAPK4 Antibody (2B2) - Azide and BSA Free Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
MAPK13 (AAH00433, 251 a.a. ~ 365 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDRRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL |
| Specificity |
MAPK13 - mitogen-activated protein kinase 13 |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
MAPK13 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1:500
|
| Application Notes |
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for p38 delta/SAPK4 Antibody (2B2) - Azide and BSA Free
Background
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and cellular stress. MAP kinase kinases 3, and 6 can phosphorylate and activate this kinase. Transcription factor ATF2, and microtubule dynamics regulator stathmin have been shown to be the substrates of this kinase.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
Publications for p38 delta/SAPK4 Antibody (H00005603-M05) (0)
There are no publications for p38 delta/SAPK4 Antibody (H00005603-M05).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for p38 delta/SAPK4 Antibody (H00005603-M05) (0)
There are no reviews for p38 delta/SAPK4 Antibody (H00005603-M05).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for p38 delta/SAPK4 Antibody (H00005603-M05) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional p38 delta/SAPK4 Products
Research Areas for p38 delta/SAPK4 Antibody (H00005603-M05)
Find related products by research area.
|
Blogs on p38 delta/SAPK4