p38 beta/MAPK11 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

p38 beta/MAPK11 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human p38 beta/MAPK11
  
  

  Source: E.coli

  Amino Acid Sequence: EDEPEAEPYDESVEAKERTLEEWKELTYQEVL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MAPK11
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25035It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for p38 beta/MAPK11 Recombinant Protein Antigen

• EC 2.7.11
• EC 2.7.11.24
• MAP kinase 11
• MAP kinase p38 beta
• MAPK 11
• MAPK11
• mitogen-activated protein kinase 11
• Mitogen-activated protein kinase p38 beta
• mitogen-activated protein kinase p38-2
• MPK11
• p38 beta
• p38b
• p38beta
• P38BETA2
• PRKM11
• SAPK2B
• SAPK2p38-2P38B
• Stress-activated protein kinase 2
• stress-activated protein kinase-2
• stress-activated protein kinase-2b

Background

MAPK11 is encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation, and development. This kinase is most closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and environmental stress. This kinase is activated through its phosphorylation by MAP kinase kinases (MKKs), preferably by MKK6. Transcription factor ATF2/CREB2 has been shown to be a substrate of this kinase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAPK11