P2Y1/P2RY1 Antibody - BSA Free

Western Blot: P2Y1/P2RY1 Antibody [NBP1-69246] - Lane 1: Human liver, 25 ug. Lane 2: HEK293 cells, 25 ug. Antibody at 1 ug/mL.

Western Blot: P2Y1/P2RY1 Antibody [NBP1-69246] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml.

Western Blot: P2Y1/P2RY1 Antibody [NBP1-69246]

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

P2Y1/P2RY1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal region of human P2Y1/P2RY1. The peptide sequence was selected from the N terminal of P2Y1/P2RY1 (NP_002554). VAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: P2RY1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30277246).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for P2Y1/P2RY1 Antibody - BSA Free

• ATP receptor
• P2 purinoceptor subtype Y1
• P2RY1
• P2Y purinoceptor 1
• P2Y1
• P2Y1platelet ADP receptor
• purinergic receptor P2Y, G-protein coupled, 1
• Purinergic receptor

Background

P2RY12 belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is involved in platelets aggregation, and is a potential target for the treatment of thromboembolisms and other clotting disorders.The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is involved in platelets aggregation, and is a potential target for the treatment of thromboembolisms and other clotting disorders. Two transcript variants encoding the same isoform have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for P2Y1/P2RY1 Antibody (NBP1-69246)(4)

Publications using NBP1-69246

• Wei W, Sun Z, He S et al. Mechanical ventilation induces lung and brain injury through ATP production, P2Y1 receptor activation and dopamine release Bioengineered 2022-02-01 [PMID: 35034579] (WB, Mouse)
• Iannucci J, Rao HV, Grammas P High Glucose and Hypoxia-Mediated Damage to Human Brain Microvessel Endothelial Cells Induces an Altered, Pro-Inflammatory Phenotype in BV-2 Microglia In Vitro Elife 2020-10-19 [PMID: 33136275] (Western Blot, Mouse)
• O'Brien CE, Santos PT, Kulikowicz E et al. Neurologic effects of short-term treatment with a soluble epoxide hydrolase inhibitor after cardiac arrest in pediatric swine Elife 2020-10-19 [PMID: 33129262]
• Meacham KA, Cortes MP, Wiggins EM et al. Altered zinc balance in the Atp7b-/- mouse reveals a mechanism of copper toxicity in Wilson disease. Metallomics. 2018-10-02 [PMID: 30277246] (WB, Mouse)

Bioinformatics

• Gene Symbol: P2RY1
• Entrez:
  • 64805(Human)