P2Y1/P2RY1 Antibody


Western Blot: P2Y1/P2RY1 Antibody [NBP1-69246]
Western Blot: P2Y1/P2RY1 Antibody [NBP1-69246] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

P2Y1/P2RY1 Antibody Summary

Synthetic peptides corresponding to P2RY12(purinergic receptor P2Y, G-protein coupled, 12) The peptide sequence was selected from the N terminal of P2RY12 (NP_795345). VAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for P2Y1/P2RY1 Antibody

  • ATP receptor
  • P2 purinoceptor subtype Y1
  • P2RY1
  • P2Y purinoceptor 1
  • P2Y1
  • P2Y1platelet ADP receptor
  • purinergic receptor P2Y, G-protein coupled, 1
  • Purinergic receptor


P2RY12 belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is involved in platelets aggregation, and is a potential target for the treatment of thromboembolisms and other clotting disorders.The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is involved in platelets aggregation, and is a potential target for the treatment of thromboembolisms and other clotting disorders. Two transcript variants encoding the same isoform have been identified for this gene.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Pm
Applications: WB, DB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mk, Pm
Applications: IHC, IHC-P, ICC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, IHC

Publications for P2Y1/P2RY1 Antibody (NBP1-69246) (0)

There are no publications for P2Y1/P2RY1 Antibody (NBP1-69246).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for P2Y1/P2RY1 Antibody (NBP1-69246) (0)

There are no reviews for P2Y1/P2RY1 Antibody (NBP1-69246). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for P2Y1/P2RY1 Antibody (NBP1-69246) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional P2Y1/P2RY1 Products

Bioinformatics Tool for P2Y1/P2RY1 Antibody (NBP1-69246)

Discover related pathways, diseases and genes to P2Y1/P2RY1 Antibody (NBP1-69246). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for P2Y1/P2RY1 Antibody (NBP1-69246)

Discover more about diseases related to P2Y1/P2RY1 Antibody (NBP1-69246).

Pathways for P2Y1/P2RY1 Antibody (NBP1-69246)

View related products by pathway.

PTMs for P2Y1/P2RY1 Antibody (NBP1-69246)

Learn more about PTMs related to P2Y1/P2RY1 Antibody (NBP1-69246).

Research Areas for P2Y1/P2RY1 Antibody (NBP1-69246)

Find related products by research area.

Blogs on P2Y1/P2RY1

There are no specific blogs for P2Y1/P2RY1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our P2Y1/P2RY1 Antibody and receive a gift card or discount.


Gene Symbol P2RY1