P2Y1/P2RY1 Antibody

Images

 
Western Blot: P2Y1/P2RY1 Antibody [NBP1-69246]
Western Blot: P2Y1/P2RY1 Antibody [NBP1-69246] - Analysis of 293T cell lysate. Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

P2Y1/P2RY1 Antibody Summary

Immunogen
Synthetic peptides corresponding to P2RY12(purinergic receptor P2Y, G-protein coupled, 12) The peptide sequence was selected from the N terminal of P2RY12 (NP_795345). VAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
P2RY1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for P2Y1/P2RY1 Antibody

  • ATP receptor
  • P2 purinoceptor subtype Y1
  • P2RY1
  • P2Y purinoceptor 1
  • P2Y1
  • P2Y1platelet ADP receptor
  • purinergic receptor P2Y, G-protein coupled, 1
  • Purinergic receptor

Background

P2RY12 belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is involved in platelets aggregation, and is a potential target for the treatment of thromboembolisms and other clotting disorders.The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is involved in platelets aggregation, and is a potential target for the treatment of thromboembolisms and other clotting disorders. Two transcript variants encoding the same isoform have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-39032
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33870
Species: Hu, Fe
Applications: ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-32470
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
NLS877
Species: Hu, Mk, Pm
Applications: IHC, IHC-P, ICC
NLS5011
Species: Hu, Mk, Pm
Applications: IHC-P
NBP2-19655
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1658
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00005025-B01P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-37382
Species: Hu
Applications: WB, ELISA, Flow
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27562
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for P2Y1/P2RY1 Antibody (NBP1-69246) (0)

There are no publications for P2Y1/P2RY1 Antibody (NBP1-69246).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for P2Y1/P2RY1 Antibody (NBP1-69246) (0)

There are no reviews for P2Y1/P2RY1 Antibody (NBP1-69246). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for P2Y1/P2RY1 Antibody (NBP1-69246) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional P2Y1/P2RY1 Products

Bioinformatics Tool for P2Y1/P2RY1 Antibody (NBP1-69246)

Discover related pathways, diseases and genes to P2Y1/P2RY1 Antibody (NBP1-69246). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for P2Y1/P2RY1 Antibody (NBP1-69246)

Discover more about diseases related to P2Y1/P2RY1 Antibody (NBP1-69246).
 

Pathways for P2Y1/P2RY1 Antibody (NBP1-69246)

View related products by pathway.

PTMs for P2Y1/P2RY1 Antibody (NBP1-69246)

Learn more about PTMs related to P2Y1/P2RY1 Antibody (NBP1-69246).
 

Research Areas for P2Y1/P2RY1 Antibody (NBP1-69246)

Find related products by research area.

Blogs on P2Y1/P2RY1

There are no specific blogs for P2Y1/P2RY1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our P2Y1/P2RY1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol P2RY1
Entrez
Uniprot