p19 INK4d Antibody

Western Blot: p19 INK4d Antibody [H00001032-D01P] - Analysis of CDKN2D expression in transfected 293T cell line by CDKN2D polyclonal antibody.Lane 1: CDKN2D transfected lysate(17.70 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: p19 INK4d Antibody [H00001032-D01P] - Analysis of antibody to CDKN2D on HeLa cell. Antibody concentration 10 ug/ml.

Product Discontinued

p19 INK4d Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: CDKN2D (NP_001791.1, 1 a.a. - 166 a.a.) full-length human protein. MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
• Specificity: CDKN2D - cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDKN2D
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against transfected lysate for WB and recombinant protein with GST tag for ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for p19 INK4d Antibody

• CDK inhibitor p19INK4d
• cell cycle inhibitor, Nur77 associating protein
• cyclin-dependent kinase 4 inhibitor D p19
• cyclin-dependent kinase 4 inhibitor D
• cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
• inhibitor of cyclin-dependent kinase 4d
• INK4D
• p19
• p19-INK4D

Background

The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. The abundance of the transcript of this gene was found to oscillate in a cell-cycle dependent manner with the lowest expression at mid G1 and a maximal expression during S phase. The negative regulation of the cell cycle involved in this protein was shown to participate in repressing neuronal proliferation, as well as spermatogenesis. Two alternatively spliced variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CDKN2D
• Entrez:
  • 1032(Human)
• Uniprot:
  • NP_001791.1(Human)