p18INK4c/CDKN2C Antibody

Images

 
Western Blot: p18INK4c/CDKN2C Antibody [H00001031-B02P] - Analysis of CDKN2C expression in transfected 293T cell line by CDKN2C polyclonal antibody. Lane 1: CDKN2C transfected lysate(18.48 KDa). Lane 2: Non-transfected ...read more
Immunocytochemistry/ Immunofluorescence: p18INK4c/CDKN2C Antibody [H00001031-B02P] - Analysis of purified antibody to CDKN2C on HeLa cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

p18INK4c/CDKN2C Antibody Summary

Immunogen
CDKN2C (NP_001253.1, 1 a.a. - 168 a.a.) full-length human protein. MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CDKN2C
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB, Functional and IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for p18INK4c/CDKN2C Antibody

  • CDK6 inhibitor p18
  • CDKN2C
  • CDKN6
  • cyclin-dependent inhibitor
  • cyclin-dependent kinase 4 inhibitor C
  • Cyclin-dependent kinase 6 inhibitor
  • cyclin-dependent kinase inhibitor 2C (p18, inhibits CDK4)
  • INK4Ccyclin-dependent kinase 6 inhibitor p18
  • p18
  • p18INK4c
  • p18-INK4C
  • p18-INK6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
AF1555
Species: Hu
Applications: WB
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87262
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7557
Species: Hu
Applications: WB, IHC
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for p18INK4c/CDKN2C Antibody (H00001031-B02P) (0)

There are no publications for p18INK4c/CDKN2C Antibody (H00001031-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p18INK4c/CDKN2C Antibody (H00001031-B02P) (0)

There are no reviews for p18INK4c/CDKN2C Antibody (H00001031-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for p18INK4c/CDKN2C Antibody (H00001031-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional p18INK4c/CDKN2C Products

Bioinformatics Tool for p18INK4c/CDKN2C Antibody (H00001031-B02P)

Discover related pathways, diseases and genes to p18INK4c/CDKN2C Antibody (H00001031-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for p18INK4c/CDKN2C Antibody (H00001031-B02P)

Discover more about diseases related to p18INK4c/CDKN2C Antibody (H00001031-B02P).
 

Pathways for p18INK4c/CDKN2C Antibody (H00001031-B02P)

View related products by pathway.

PTMs for p18INK4c/CDKN2C Antibody (H00001031-B02P)

Learn more about PTMs related to p18INK4c/CDKN2C Antibody (H00001031-B02P).
 

Research Areas for p18INK4c/CDKN2C Antibody (H00001031-B02P)

Find related products by research area.

Blogs on p18INK4c/CDKN2C

There are no specific blogs for p18INK4c/CDKN2C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our p18INK4c/CDKN2C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDKN2C
Entrez
Uniprot