Recombinant Human OXGR1/GPR80/P2Y15 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human OXGR1/GPR80/P2Y15 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-337 of Human OXGR1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNEPLDYLANASDFPDYAAAFGNCTDENIPLKMHYLPVIYGIIFLVGFPGNAVVISTYIFKMRPWKSSTIIMLNLACTDLLYLTSLPFLIHYYASGENWIFGDFMCKFIRFSFHFNLYSSILFLTCFSIFRYCVIIHPMSCFSIHKTRCAVVACAVVWIISLVAVIPMTFLITSTNRTNRSACLDLTSSDELNTIKWYNLILTATTFCLPLVIVTLCYTTIIHTLTHGLQTDSCLKQKARRLTILLLLAFYVCFLPFHILRVIRIESRLLSISCSIENQIHEAYIVSRPLAALNTFGNLLLYVVVSDNFQQAVCSTVRCKVSGNLEQAKKISYSNNP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
OXGR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
64.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OXGR1/GPR80/P2Y15 Protein

  • Alpha-ketoglutarate receptor 1
  • G protein-coupled receptor 80
  • G protein-coupled receptor 99
  • GPR80
  • GPR802-oxoglutarate receptor 1
  • GPR99
  • G-protein coupled receptor 80
  • G-protein coupled receptor 99
  • MGC119206
  • MGC119207
  • MGC119208
  • OXGR1
  • oxoglutarate (alpha-ketoglutarate) receptor 1
  • Oxoglutarate Receptor 1
  • P2RY15
  • P2RY15P2Y-like GPCR
  • P2Y purinoceptor 15
  • P2Y15
  • P2Y15P2Y-like nucleotide receptor
  • seven transmembrane helix receptor

Background

G protein-coupled receptors (GPCRs, or GPRs) contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32822
Species: Hu, Mu, Rt, Av, Ce
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
AF2007
Species: Hu
Applications: WB
NLS418
Species: Hu
Applications: IHC-P
NLS2756
Species: Hu, Mk
Applications: IHC-P, ICC
H00442206-R02
Species: Hu
H00441931-R02
Species: Hu
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NLS442
Species: Hu
Applications: IHC-P
NBP1-02658
Species: Hu
Applications: ICC/IF (-), WB, IHC, IHC-P
NBP1-84903
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-02393
Species: Hu
Applications: IHC, IHC-P
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB300-318
Species: Hu, Mu, Rt
Applications: IP (-), WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-00861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1584
Species: Hu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
NLS2573
Species: Hu
Applications: IHC-P

Publications for OXGR1/GPR80/P2Y15 Recombinant Protein (H00027199-P01) (0)

There are no publications for OXGR1/GPR80/P2Y15 Recombinant Protein (H00027199-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OXGR1/GPR80/P2Y15 Recombinant Protein (H00027199-P01) (0)

There are no reviews for OXGR1/GPR80/P2Y15 Recombinant Protein (H00027199-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OXGR1/GPR80/P2Y15 Recombinant Protein (H00027199-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OXGR1/GPR80/P2Y15 Products

Bioinformatics Tool for OXGR1/GPR80/P2Y15 Recombinant Protein (H00027199-P01)

Discover related pathways, diseases and genes to OXGR1/GPR80/P2Y15 Recombinant Protein (H00027199-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OXGR1/GPR80/P2Y15 Recombinant Protein (H00027199-P01)

Discover more about diseases related to OXGR1/GPR80/P2Y15 Recombinant Protein (H00027199-P01).
 

Pathways for OXGR1/GPR80/P2Y15 Recombinant Protein (H00027199-P01)

View related products by pathway.

PTMs for OXGR1/GPR80/P2Y15 Recombinant Protein (H00027199-P01)

Learn more about PTMs related to OXGR1/GPR80/P2Y15 Recombinant Protein (H00027199-P01).
 

Research Areas for OXGR1/GPR80/P2Y15 Recombinant Protein (H00027199-P01)

Find related products by research area.

Blogs on OXGR1/GPR80/P2Y15

There are no specific blogs for OXGR1/GPR80/P2Y15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

xCT Antibody
NB300-318

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human OXGR1/GPR80/P2Y15 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol OXGR1
Entrez