OTUD7A Antibody - Azide and BSA Free

Western Blot: OTUD7A Antibody [NBP2-93314] - Analysis of extracts of U-251MG cells, using OTUD7A at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.

Product Discontinued

OTUD7A Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 800-900 of mouse OTUD7A (NP_570950.1). RPCATYPQQNRSLWSQSYSPARSALRTVNTVESLAPGGADAPGPAEHKSQTYSNGFGAARDGLEFADADAPAARSNAECGRGGPGPAQRRCQRENCAFYGR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OTUD7A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:200-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for OTUD7A Antibody - Azide and BSA Free

• C15orf16
• C16orf15
• CEZANNE2C16ORF15
• chromosome 15 open reading frame 16
• EC 3.4.19.12
• OTU domain containing 7
• OTU domain containing 7A
• OTU domain-containing protein 7A
• OTUD7cezanne 2
• Zinc finger protein Cezanne 2

Background

Deubiquitinating enzymes (DUBs; see MIM 603478) are proteases that specifically cleave ubiquitin (MIM 191339) linkages, negating the action of ubiquitin ligases. OTUD7A belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: OTUD7A