Recombinant Human OTOA GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human OTOA GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 27-124 of Human OTOA
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: NSRQDLHPLLQNMAEEIIDGSYLNALLDLIQFQSSHVWTDDLSHRVLAYLNSRNVAFTIPSLQAAVENHLEQRLHQPQKLLEDLRKTDAQQFRTAMKC

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: OTOA
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 36.52 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OTOA GST (N-Term) Protein

• cancer/testis antigen 108
• CT108
• deafness, autosomal recessive 22
• DFNB22
• FLJ32773
• MGC157747
• MGC39813
• OTOA
• otoancorin

Background

The protein encoded by the OTOA gene is specifically expressed in the inner ear, and is located at the interface betweenthe apical surface of the inner ear sensory epithelia and their overlying acellular gels. It is prposed that thisprotein is involved in the attachment of the inner ear acellular gels to the apical surface of the underlyingnonsensory cells. Mutations in this gene are associated with autosomal recessive deafness type 22 (DFNB22).Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (provided byRefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: OTOA