OR2H1 Antibody

Images

 
Western Blot: OR2H1 Antibody [NBP2-86737] - Host: Rabbit. Target Name: OR2H1. Sample Type: HT1080 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OR2H1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR2H1. Peptide sequence: GRGKFFGLFYAVGTPSLNPLVYTLRNKEIKRALRRLLGKERDSRESWRAA The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
OR2H1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OR2H1 Antibody

  • family 2, subfamily H, member 6
  • Hs6M1-16
  • Olfactory receptor 2H6
  • olfactory receptor, family 2, subfamily H, member 1,6M1-16
  • olfactory receptor, family 2, subfamily H, member 8
  • OLFR42A-9004-14
  • OR2H8
  • OR6-2HS6M1-16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07526
Species: Hu
NBP2-45312
Species: Hu, Pm, Mu(-)
Applications: WB, Flow, IHC, IHC-P, IF
NBP1-43123
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, B/N, CyTOF-ready, Flow-CS
NBP1-59537
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-98301
Species: Hu
Applications: WB
NBP2-67917
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-43728
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP3-03661
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-53380
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-86483
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02864
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00002550-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, RNAi
NB100-64775
Species: Hu, Mu, Pm, Bv, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, CyTOF-ready, IHC-P (-)

Publications for OR2H1 Antibody (NBP2-86737) (0)

There are no publications for OR2H1 Antibody (NBP2-86737).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OR2H1 Antibody (NBP2-86737) (0)

There are no reviews for OR2H1 Antibody (NBP2-86737). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OR2H1 Antibody (NBP2-86737) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional OR2H1 Products

Bioinformatics Tool for OR2H1 Antibody (NBP2-86737)

Discover related pathways, diseases and genes to OR2H1 Antibody (NBP2-86737). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OR2H1 Antibody (NBP2-86737)

Discover more about diseases related to OR2H1 Antibody (NBP2-86737).

PTMs for OR2H1 Antibody (NBP2-86737)

Learn more about PTMs related to OR2H1 Antibody (NBP2-86737).

Blogs on OR2H1

There are no specific blogs for OR2H1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OR2H1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OR2H1