OIP5 Recombinant Protein Antigen

Images

 
There are currently no images for OIP5 Protein (NBP2-13688PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

OIP5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human OIP5.

Source: E. coli

Amino Acid Sequence: CGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
OIP5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13688. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for OIP5 Recombinant Protein Antigen

  • Cancer/testis antigen 86
  • CT865730547N13Rik
  • hMIS18beta
  • LAP2alpha interactor-25
  • LINT-25
  • MIS18B
  • MIS18beta
  • OIP-5
  • Opa interacting protein 5
  • Opa-interacting protein 5
  • protein Mis18-beta

Background

Commonly referred to as OIP5, Opa interacting protein 5 is essential to protein binding. More specifically, OIP5 is necessary for the recruitment of CENPA to centromeres and normal chromosome segregation during mitosis. OIP5 interacts with other proteins such as RAF1, BRAF, CENPA, CENPN, and HJURP and also binds UBC, TMPO, MIS18A, CASP10 and RARG.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-13389
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-89905
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-47714
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-88944
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-15837
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NBP3-27151
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-16391
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-24590
Species: Mu
Applications: IHC,  IHC-P, WB
NBP1-84350
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-47663
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-97692
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP2-13688PEP
Species: Hu
Applications: AC

Publications for OIP5 Protein (NBP2-13688PEP) (0)

There are no publications for OIP5 Protein (NBP2-13688PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OIP5 Protein (NBP2-13688PEP) (0)

There are no reviews for OIP5 Protein (NBP2-13688PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for OIP5 Protein (NBP2-13688PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OIP5 Products

Research Areas for OIP5 Protein (NBP2-13688PEP)

Find related products by research area.

Blogs on OIP5

There are no specific blogs for OIP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our OIP5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol OIP5