Recombinant Human ODAM Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ODAM Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-153 of Human ODAM full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLAEPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYLQKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ODAM

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ODAM Protein

  • APIN
  • FLJ20513
  • ODAM
  • odontogenic ameloblast-associated protein
  • odontogenic, ameloblast asssociated

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46517
Species: Hu
Applications: WB, IHC
AF3026
Species: Mu
Applications: WB
NBP1-62322
Species: Hu
Applications: WB
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
MAB1142
Species: Hu
Applications: WB, Flow, CyTOF-ready
46780002
Species: Hu
Applications: ELISA
NBP1-87446
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006532-M06
Species: Hu
Applications: ELISA, IP
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP1-88899
Species: Hu
Applications: IHC, IHC-P
20620002
Species: Hu
Applications: ELISA, IHC, IHC-P
H00055821-D01P
Species: Hu, Mu
Applications: WB, ELISA
H00000265-M03
Species: Hu
Applications: WB, ELISA
H00054959-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ODAM Recombinant Protein (H00054959-P01) (0)

There are no publications for ODAM Recombinant Protein (H00054959-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ODAM Recombinant Protein (H00054959-P01) (0)

There are no reviews for ODAM Recombinant Protein (H00054959-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ODAM Recombinant Protein (H00054959-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ODAM Products

Bioinformatics Tool for ODAM Recombinant Protein (H00054959-P01)

Discover related pathways, diseases and genes to ODAM Recombinant Protein (H00054959-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ODAM Recombinant Protein (H00054959-P01)

Discover more about diseases related to ODAM Recombinant Protein (H00054959-P01).
 

Pathways for ODAM Recombinant Protein (H00054959-P01)

View related products by pathway.

PTMs for ODAM Recombinant Protein (H00054959-P01)

Learn more about PTMs related to ODAM Recombinant Protein (H00054959-P01).

Blogs on ODAM

There are no specific blogs for ODAM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMP-2 [Unconjugated]
355-BM-010/CF
ODAM Antibody (2F8)
H00054959-M02

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ODAM Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ODAM
Entrez